SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012049 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012049
Domain Number 1 Region: 242-348
Classification Level Classification E-value
Superfamily PH domain-like 4.28e-26
Family Pleckstrin-homology domain (PH domain) 0.0000214
Further Details:      
 
Domain Number 2 Region: 5-101
Classification Level Classification E-value
Superfamily PH domain-like 7.45e-26
Family Pleckstrin-homology domain (PH domain) 0.0000225
Further Details:      
 
Domain Number 3 Region: 120-235
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.99e-24
Family DEP domain 0.0000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012049   Gene: ENSGACG00000009115   Transcript: ENSGACT00000012073
Sequence length 351
Comment pep:known_by_projection group:BROADS1:groupVI:10585490:10589570:-1 gene:ENSGACG00000009115 transcript:ENSGACT00000012073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPQQIREGYLVKKGTLLNSWKAVWVVLSDDGLEFYKKKTDRSPKGMIPLKGAVLVNPCQ
DFGKRMLVFKITTDRKQDHFFQASHVEEREFWVKDIKRVITCLDGGRKFARKSTRRSIRL
PDKVNLTELYALMKDQDGGVKELKLEQESRVFNHCFTGATVVEWLISKEKARNRPEALML
ATGLLNEGFLQPAGDLSKEGAESGEQTVFLDETIALYYFADSGFFCEGYSSDEDVLLKEE
FRGNIVKQGCLLKQGHKRKNWKVRKFVLRDDPAFMHYYDPTKGDDPLGSIHLRGSVVTAV
EFVPDAKKYDVDGDLFEIITSDETHYFLQAAKAEERKEWITAIQAVSKSGK
Download sequence
Identical sequences G3P376
ENSGACP00000012049 ENSGACP00000012049 69293.ENSGACP00000012049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]