SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012121 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000012121
Domain Number - Region: 294-328
Classification Level Classification E-value
Superfamily UBA-like 0.0714
Family TS-N domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012121   Gene: ENSGACG00000009181   Transcript: ENSGACT00000012145
Sequence length 333
Comment pep:known_by_projection group:BROADS1:groupXVI:17776642:17785106:1 gene:ENSGACG00000009181 transcript:ENSGACT00000012145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPYRRDTGRKPYSVDPADGASGTPGGELTPESPTGDAPDSGNPPATGRQPQYSGGFTVI
PPNESLRDKLRRNAQKEEEELQRWKEANRVTYVHADPEKLGGAATLAATREMQHTDLRCS
KLQKRLKKEELDKRRRQEEEEENQRKKDIQREKAERLEARRRQEEQRRREQLSQDRARKT
ESFLQRFERAAPCPPASGGAAQTPHKAVEIKPKGERDVQQEHRRVNQAFLDSLEGRRRGS
EQATRAPPLLAPDDFRHGPCDLAGQRVAPALPDADPDHSFADWTDEADPACDGALVKLLK
SFPGCSRSFLEDILDQCSGDHQQAHALLDCTMN
Download sequence
Identical sequences G3P3E8
ENSGACP00000012121 69293.ENSGACP00000012121 ENSGACP00000012121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]