SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012127 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012127
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000145
Family Ubiquitin-related 0.025
Further Details:      
 
Domain Number 2 Region: 101-158
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000368
Family Ubiquitin-related 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012127   Gene: ENSGACG00000009187   Transcript: ENSGACT00000012151
Sequence length 193
Comment pep:known_by_projection group:BROADS1:groupVIII:11403293:11405044:1 gene:ENSGACG00000009187 transcript:ENSGACT00000012151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIFICFEGSSEPIDVPSDQTVGAVKHMIKDNFMVRLSYDKQQQYLELSHGGAVLQDSWA
LFDVGITNGRAIQCLIKSEQRPAMWLFNAVTQETLPVMGNEASLHMSVAHLKTVVSMQTG
LPVSTFRLSTPAGVQLYDCNQLKDYAIKEDKGTTLRLDTWDGWVQFLRGCLRGRRLTVQG
HLLEKIPVKRSEI
Download sequence
Identical sequences G3P3F4
ENSGACP00000012127 69293.ENSGACP00000012127 ENSGACP00000012127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]