SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012137 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012137
Domain Number 1 Region: 612-890
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.81e-93
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000946
Further Details:      
 
Domain Number 2 Region: 93-196
Classification Level Classification E-value
Superfamily Second domain of FERM 4.58e-30
Family Second domain of FERM 0.00028
Further Details:      
 
Domain Number 3 Region: 194-323
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-27
Family Third domain of FERM 0.00063
Further Details:      
 
Domain Number 4 Region: 490-585
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-19
Family PDZ domain 0.00021
Further Details:      
 
Domain Number 5 Region: 6-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.58e-19
Family First domain of FERM 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012137   Gene: ENSGACG00000009182   Transcript: ENSGACT00000012161
Sequence length 902
Comment pep:known_by_projection group:BROADS1:groupXX:10758440:10770927:-1 gene:ENSGACG00000009182 transcript:ENSGACT00000012161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DMPKPDLLCLVQLLDSTIETFRVSKQDEGVVLLDQVCDHLGLQERQLFSLQIRESDDDNH
RRWLEPEKPLKKQLKGLAPPFYMNFRVRFFMSDPNSLQHEQTRHLYFLQIRSDIREGRLQ
CPLSAAVVLASYAVQSEMGDHCPSRLPGYLAKCYFIPEQDEDLPSKVEDLHPQHKGLKQS
EAELCFLNTARTLELYGVELHGATDTNDTPLLVGLASSGVAIFCNRICSSFFPWANIIKI
SFKRKRFLIHLKRKHGETQDCEVSLVLPCPKTCKNLWRSSVDHHSFFCSNRTVKSPKHNN
TTVQSYRKLITQHLGLGNSKFESMYIFVTNTKNGPMCQRVVGGMVWNPVLRRSISSDNLE
TKSLPSRSPPNTPNWRSSRVRHGLRKPRPSSAELTNDLKDMSEGEDVFYTYRASVSSSKD
SEGDTSPHQKNVFWQTPIWCSCPYQSYTSCAEPSAVTLHSKQTLICFISNPLDGVESTDD
YIKPGALGDGDLMLICIAPDHDGKFGFNVKGGVDQKMPLAISHVKPDSPAGRCEPKLLEG
DLVVLINGRDISEHTHNQVVMFIRASRESHSRELALLIRRPGRVAPLLQLPPALTLTGQS
QGDKLSAGQSERVTTVEESMRQLERGIQSGTLCFHFENLYRRKPGLSLNCARLRENTEKN
RYKDVLPYDATRVVLQGPEDYVNASHIKMVPPASGVCLRYVAAQGPLPQTITHFWQTVWE
QQIHTIIMLTTLTERGRTKCHQYWPHPPEVKDYGHMRVKCHSEECNLAYVTRQFTLTHTQ
RGEERTVTHLQYVAWPDHGVPDDPSDFLLFITSVRERRRGEEPLMVHCSAGIGRTGVLIT
METALTLLDGGRPVFPLDIVKTLRDQRAMMIQTTCQFQFVCKAILRVYKVGAQQRGLLAF
PR
Download sequence
Identical sequences G3P3G4
ENSGACP00000012137 ENSGACP00000012137 69293.ENSGACP00000012137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]