SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012140 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012140
Domain Number 1 Region: 323-456,740-914
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.49e-48
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 223-292
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.18e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000386
Further Details:      
 
Domain Number 3 Region: 53-176
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000205
Family Pleckstrin-homology domain (PH domain) 0.0091
Further Details:      
 
Domain Number 4 Region: 163-219
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000493
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012140   Gene: ENSGACG00000009197   Transcript: ENSGACT00000012164
Sequence length 1135
Comment pep:known_by_projection group:BROADS1:groupXVI:17838915:17873369:-1 gene:ENSGACG00000009197 transcript:ENSGACT00000012164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKGPASAAGIHAHAVGPVAGPGAADESSDSDAEQEGAQKLIRKVSTSGQIRSKTSIKEGL
LLKQTSSFQRWKKRYFKLRGRTLYYAKDAKSLIFDEVDLSDASVAESSTKNVNNSFTFIQ
WRRRLNTHAHNRTRWEDGRGGGGGVGFPKPKEPTAQFNVEHFSGMHNWYACSHARPTFCN
VCKDSLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDEDGIAMPHQW
LEGNLPVSAKCAVCDKTCGSVLRLQDWRCLWCKAMVHTACMDLYPRKCPLGQCKVSIIPP
TALNSIDSDGFWKATCPPSCASPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLVNGG
PHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLSLHKQCQLGVLPLGTGNDLARVLGW
GPSCDDDTQLPQILEKLERASTKMLDRWSIMTYEIKIPPKLSCPTTPEGPEDCQFHISAY
EDSVAAHLTKILNSEQNSVVISSAKILCETVKDFVSKVGKSYEKSTDNSDECDTMSLKCA
VLNEKLDSLLQTLNSESRALPSLAHSTPPISEESLTERCGGAPHQLFKSREHLMLRANSL
KKALRQIIEQTERADEEVSVKPSSFVSSPCFLSSPPPSFYPGRKSPKSPAAKSPCSPTER
RVSRSTQSYSSFTITPFTTSKENLPVLNTRIICPAGLRAGLAASIAGSSIISKMLLANID
PFGATPFIDPDLDSLDGYMEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRKLYKSMMW
NGLLGKKEPLARTCKGSRGPANAQCDGQYIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDD
IFCAPSFDDKILEVVAVFGSMQMAVSRVIKLQHHRIAQCRTVKITILGDEGVPIQVDGEA
WIQPPGVIKIQHKNRAQMLTRDRAFENTLKSWEDKLKYDKPPLRPHLYPQQSVDLATEEE
AAMVQLCARAAEELITRICEAAKTNGLLEQELAHAVNASSHAINKTHPKFPESLTRNTAM
EVASTVKALYYETESLLLGRVSLQLDPPEEDQLSGALQSLELELAKLGEVAWLYHILQPN
DEEDLSLGYGKRNSRSSMFRIVPKFKKEKAAKKTSPQSGSGDIESGSYEENSPGN
Download sequence
Identical sequences G3P3G7
69293.ENSGACP00000012140 ENSGACP00000012140 ENSGACP00000012140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]