SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012144 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012144
Domain Number 1 Region: 4-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.42e-82
Family BAR domain 0.00063
Further Details:      
 
Domain Number 2 Region: 401-517
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.97e-44
Family Pyk2-associated protein beta ARF-GAP domain 0.00017
Further Details:      
 
Domain Number 3 Region: 261-364
Classification Level Classification E-value
Superfamily PH domain-like 5.65e-27
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 4 Region: 612-730
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.14e-24
Family Ankyrin repeat 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012144   Gene: ENSGACG00000009198   Transcript: ENSGACT00000012168
Sequence length 781
Comment pep:known_by_projection group:BROADS1:groupVIII:11419321:11452012:1 gene:ENSGACG00000009198 transcript:ENSGACT00000012168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKITVDFEECLQDSPRFRATIEDVEGDVCELESKLDKLVKLCIGMIDAGKAYNAANKQFV
NGIRELAQQSTRDEVIESSLTKFAESLQEMINYHTILFDQVQRSIKTQLQTFVKDDIRKF
KEAKKHFDKVSEEKEGALIKNAQAPRNKQHEVEEATNILTATRKCFRHIVLDYVLQINVL
QSKRRSEILKSMLSFMYAHLTFFHQGYDLFSELQPLMKQLGGQLDLLVVDAAKEKRDMEQ
KHSTIQQKDFSNDDTKLEYNVDAEHGIAMEGYLFKRASNAFKTWNRRWFSIQNNQLVYQK
KFKDNPTVVVEDLRLCTVKHCEDVERRFCFEVVSPTNRSCMMQADSEKLRQAWIKAVQNS
IATAFRDKGDDGDKLDRKSSTSTGSLDSAGEPKERSIKGESALQKVLVIPGNTCCCDCGQ
PDPRWASINLGITLCIQCSGIHRSLGVHFSKVRSLTLDTWEPELLKLMCELGNGVINQIY
EARREELGSRKPQPGDPRHEVEAYIKAKYVDRRFVRRPTGEELRDKVVSLSKQEKRLSSS
SEHLPPRPPPPTPKLRPGQSVKSKDSGIQNSADGSREMLATTASNTSLTDAGETQTSVVF
YEPKEYSSGLQLYWAACARSLPDMAEALAHGAVVNWVNAEDDKRTPLIMAVQGGSLVTCE
FLLQNAANVNQQDAQGRGPLHHATMLGHTGQVCLFLKRGANQNAADIDEKTPLIIAVDAA
NADIVTLLRLAKMNEEMREAEGPYSQSGDETYQDIFQDFTQMASNDPDKLNRYQQYDAQR
P
Download sequence
Identical sequences G3P3H1
69293.ENSGACP00000012144 ENSGACP00000012144 ENSGACP00000012144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]