SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012146 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012146
Domain Number 1 Region: 113-315
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.29e-62
Family DBL homology domain (DH-domain) 0.0000223
Further Details:      
 
Domain Number 2 Region: 300-444
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-31
Family Pleckstrin-homology domain (PH domain) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012146   Gene: ENSGACG00000009204   Transcript: ENSGACT00000012170
Sequence length 1376
Comment pep:known_by_projection group:BROADS1:groupXVIII:8741976:8757566:-1 gene:ENSGACG00000009204 transcript:ENSGACT00000012170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSPDSAERPISYSSTSSSASSRDSHCSLGSRSALVAAPHCNPAQPDRDSGAIWLELVPAR
QLGCREEDDRNEGRVETGRGQGRQGQTLTEHSEPEVGPDGPGEQTGQVQGPRTYVDRVVQ
EILDTERTYVQDLRSIVEDYLECISNQSQLALISEDKGSLFGNIRDIYHFNRDLLHDLEK
CNADPVAIADCFVSKSEEFHIYTQYCTNYPRSVAVLTECMRNKALAKFLRERQESLKHSL
PLGSYLLKPVQRILKYHLLLHEIANRMEKDTETYEVVQEAIDTMQRVAWHINDMKRKHEH
AVRLQEIQSLLTNWKGPDLIGYGELVLEGTFRLQRAKNERTLFLFDKLLLITKKREETYT
YKAHILCCNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQPDKRMWILHLKRLILENH
PAKIPAKAKQAILEMDAMHHPGFHYNPDGDKKDSHQTKDGPTPRRGRRKGKTSRWTREIT
MTTVTAQKARESLVREGSHHPPLVRTRRVTEEPPDPATPSVVVTESDHSVRNIWADHRAR
RAMFPTRQRTMQPEDEDEDIYQMFVPTEPSGPEPEVPSERSAATSSPAAARPCSWHVEQL
PTVQIDPPTDGGQVLRRASSAGEKATEVRQSPGDDQAGNGNLEVIHTESSSNEISGSSSA
EQLTIDDIENVYDNISYEDLKNMGLVRRDPEESLPRKDTAADAQGLQGQASRARTAPEAP
VVSEPAIEPDISPVSSQPVTHEGRPVGTLELKIVEENVYDTVCFREPPSTVLKEIHECDN
LKQERDSLLASEQDLTGSIGAFVSEESLHFGEDEGPDPSHRVPCHSEPDYSSSSASETFS
RRSQKGDKMSEQVDEIWNDLENYIKNNEKKADKHPAAFPVSAGESPKKAKTAKVKDRHPK
SPPVVSPQAASPQTKSPPTHQPKPPPVTSMPSFTIPVINLQEPSRNIPQKDLPLKDLHSL
FPGELAGLDSPLASSSLLLAESADLDLIEKSKNRVFLMARQYSQKIKKANQLLRMRSMDP
GDACCRTRTEKKQKDLAAILEEKKQGGTAIGARIAEYSHLYDQVMFKDPPGQTGPHHGHP
GLLSSPSMPETSLEEEWLHSTYSNGELVSFMSSSGELDDARASSTPQRRLTSACSTPSFR
TSPSSPTNPASQRWSSCMSAPSEEEEHVYSSIKRHPSFNAPSSPSLKSPPSSHCQSLGSL
GSKRQDAEQPGLRCAVPTDRLHGPSLGRTGRQSSLPERPTPGQSELTLRDGQQVVVLNRA
SALSILGATQNYMANFKDDGEDDDDYVEIRSEDEGEREQDRLAGRSDGSAALSDPNRGPV
HSQSLPCTPARSCDPLRSLERKQLAKYLWNEPQQSQPKIVQSLREKFQCLSSSSFA
Download sequence
Identical sequences G3P3H3
69293.ENSGACP00000012146 ENSGACP00000012146 ENSGACP00000012146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]