SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012187 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012187
Domain Number 1 Region: 6-101
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-17
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.054
Further Details:      
 
Domain Number 2 Region: 173-616
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000248
Family Armadillo repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012187   Gene: ENSGACG00000009228   Transcript: ENSGACT00000012211
Sequence length 821
Comment pep:known_by_projection group:BROADS1:groupXVIII:8805920:8812556:1 gene:ENSGACG00000009228 transcript:ENSGACT00000012211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDTRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGTSLLVRAESDGSLLLESKINPNT
AYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDVVDESEEE
RFDDMSSPGLELPPCELNRLEDLAEMVASSLPSPLRREKLALAVENEGYIRKILELFRVC
EDLENREGLHHLYEIIKGIFLLNRTALFEVMFSEECIMDVIGCLEFDPALAHPRRHREFL
TKTARFKEVIPISDPELRQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEI
VGMLQDDEKFLTDLFAQLTDEATDDDKRHELVNFLKEFCAFSQTLQPQNRDAFFKTLSNM
GILPALEVILGMDDVQVRGAATDIFSYLVEYNPSMVREFVMQESQQNDDDILLINLIIEH
MIDIDPELGGAVQLMGLLRTLVDPENMLATANKTEKTEFLSFFYKHCMHVLSAPLLANTT
EEKPSKDDFQTSQLLALILELLTFCVEHHTYHIKNYIINKDILRRVLVLTASQHAFLALC
ALRFMRRIIGLKDEFYNRYIMRNFLFEPVIKAFLNNGSRYNLMNSAIIEMFEYVRVEDVK
SLTAHIIENYWKALEDVDYVQTFKGLKLRYEQQRERQDNPKLDSMRSILRNHRFRRDART
LEDEEEMWFNTDEDDLEDGEAVVPPSDKMKSEEDLMEPISKFMERKKLKDTDDKDVLGKS
SLSGRQNPSFKLSFSGSTKTSLSSPPSSASLNPGSPGSPGSPGSGARSSASPTTVTTKGG
LVGLVDYPDDDDEDDEEDEDEEDGESKEDPLPPSKKSKLSS
Download sequence
Identical sequences G3P3L4
ENSGACP00000012187 69293.ENSGACP00000012187 ENSGACP00000012187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]