SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012258 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012258
Domain Number 1 Region: 143-258
Classification Level Classification E-value
Superfamily PH domain-like 2.19e-23
Family Pleckstrin-homology domain (PH domain) 0.0000451
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012258   Gene: ENSGACG00000009257   Transcript: ENSGACT00000012282
Sequence length 538
Comment pep:known_by_projection group:BROADS1:groupI:8890956:8899127:1 gene:ENSGACG00000009257 transcript:ENSGACT00000012282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQEKPKLIDPLDYETVISDLEDGLKEDPLRELLLFPDHDFTVSTVPQERRTLRSTVPEGA
ELQAECLLVRQACRYYNSDLNVVQFKYDDYAGDYRLLPRKLYKAEKLPSHSFEIDHEDID
KDEDTTSLSSSKGGGGGGGGGIGVFRSGWLYKGNFNSTVNNSITVRSFKRRYFQLTQLTD
NSYIMNFYKDEKISKEPKGCIFLDSCTGVVQNNRLRKHAFELKMNEVTYFVLAAESEQDM
EEWITTLTRILQISPHDGPAPDRKSLDLTDHRQDVFDLSLSDCCLQENEDTTTENGINPE
LAKYISETDEGIRSARREERLNLFSLDPDTPVLRSPRAEHSSAENAAVRPFEEKLGRRFM
ITCRSLSLMLQGCINESETGPVTNIEPFYVSLALLDVREGRKVSADFHVDLNHEAVRQML
GSCCNGTSGPPTGVGGQENSLSSPAEKKPGDCCLSSDLEHWLSLPKQAIFSVTNPHTDIV
MVARVEKVLMGNIACGAEPYIKNTDSSKTVQKILKSNKQFCSKLGKYRMPFAWSVRLV
Download sequence
Identical sequences G3P3T5
ENSGACP00000012258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]