SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012309 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012309
Domain Number 1 Region: 49-202
Classification Level Classification E-value
Superfamily PH domain-like 1.16e-28
Family Phosphotyrosine-binding domain (PTB) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012309   Gene: ENSGACG00000009337   Transcript: ENSGACT00000012333
Sequence length 346
Comment pep:known_by_projection group:BROADS1:groupVIII:11692873:11693913:1 gene:ENSGACG00000009337 transcript:ENSGACT00000012333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSWKKNKFDLIEEDALSKQKGYAVSLNYSALTSFAKSCPESALNRVGSMFKSKRKKVKI
TSEDPTYTVLYLGNATTIQSKGDGCTDVAVSKIWGKSEMGKNGTKMRLTVSSQGIRMVHV
DDKARRPGHLYLLHRVTYCVADPRLPKIFAWVYRHEMKHKAVMLRCHAVLVSKPEKAKAM
ALLLYQTSATALAEFKRLKRRDDARHQQQRLIGEQTIPLVPIRKLLNGQCCYKPPVERSR
SAPKLGSITEDLVGEEEEEKAMHFEYEDILDTDGERVANGKQEWSQIINDLGEMSIGNDV
QTLKADLRVTRLLSGESTGSESSIENSQEHVTLTNGFGEVKVQEIA
Download sequence
Identical sequences G3P3Y6
ENSGACP00000012309 69293.ENSGACP00000012309 ENSGACP00000012309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]