SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012318 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012318
Domain Number 1 Region: 994-1101
Classification Level Classification E-value
Superfamily PDZ domain-like 9.73e-26
Family PDZ domain 0.0000944
Further Details:      
 
Domain Number 2 Region: 1150-1252
Classification Level Classification E-value
Superfamily PDZ domain-like 5.65e-24
Family PDZ domain 0.00012
Further Details:      
 
Domain Number 3 Region: 460-571
Classification Level Classification E-value
Superfamily PDZ domain-like 7.23e-24
Family PDZ domain 0.0000258
Further Details:      
 
Domain Number 4 Region: 826-933
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-23
Family PDZ domain 0.00038
Further Details:      
 
Domain Number 5 Region: 645-749
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-21
Family PDZ domain 0.00025
Further Details:      
 
Domain Number 6 Region: 130-190
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.95e-16
Family Nucleotide and nucleoside kinases 0.0034
Further Details:      
 
Domain Number 7 Region: 312-350
Classification Level Classification E-value
Superfamily WW domain 0.00000000000282
Family WW domain 0.0013
Further Details:      
 
Domain Number 8 Region: 9-104
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000666
Family PDZ domain 0.026
Further Details:      
 
Domain Number 9 Region: 371-408
Classification Level Classification E-value
Superfamily WW domain 0.000000000195
Family WW domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012318   Gene: ENSGACG00000009341   Transcript: ENSGACT00000012342
Sequence length 1273
Comment pep:known_by_projection group:BROADS1:groupXVII:9028619:9122556:-1 gene:ENSGACG00000009341 transcript:ENSGACT00000012342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNPALKKNHWTSRVSECSVAKDARGELSVPLRGGAENGEFAHIGPVNEALVVFKSGKIY
EGELLLEVEKLPISGLPLYDVQTVIKNCKGPVRLKTVRQGSKLNKDLKHYLSQRFQKSSP
DHELQQTIRDNLYRHAVPCTTRGPRDGEVSGVDYNFLSVEDFLKLEKSGTLLEIGTFDGN
YYGTPKPPVQPPSGKVINSGGIGGDAPLPDGLSGSLPGSQHSTPRRRSKSYNDMHNAGIG
PGERQEDDDEDLPDMTSSFTGDSSELDEIPHSARPYAPRKSDPPYVGRTPSPSATTESTQ
QSNSHLSHPPPEDPLGILPDNWEMAYTESGEVYFIDHNTKTTSWIDPRCMDKPQKPLEEC
EDDEGVHTEELDNDLELPPGWEKIDDPVYGVYYVDHINRKTQYENPMLEAKRRRQLEQQQ
PQQQWMEDSALAGAPLASYAANHQETYRDPQKGPPMPNAMGQKRGKPFFTRNRSELKGTF
INTKLKKSRRGFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDICVLGY
THAQVVKIFQSIPIGSMVNLELCRGYPLPFDPDDPNTSLVTSVAIIDNKDPIIVNGQDGS
HNYDLPPSHGSQNNNIGSTNGGAPLNGLPRPHSPSADVASDTSSQHGYPSDVVTLASSIA
TQPELITVHMEKGDKGFGFTIADSPGGGGQRVKQIVDYPRCRGLKEGDIIVEVNKRNVQS
MSHNQVVDLLSKCPKGSEVTMLVQRGFTGVAPAKKSPKLEQLSRKDSQNSSQHSVSSHRS
IHTDSPLHSSLPLSESIAPPPPSQPLPGLPPQDPPADGTIQRKPDPFKIWAQSRSMYESR
LPDFQEQDIFLWRKDTGFGFRILGGNEPGEPIYIGHIVKYGAADEDGRLRSGDELICVDG
TPVVGKSHQLVVQLMQQAAKQGHVNLTVRRKTNYAVKAEGDVPPSPASSHHSSNQAPSLT
EEMGKRTPQGSQNSLNTVSSGSGSTSGIGPPNVASNAPSALQPYDVEIRRGESEGFGFVI
VSSVSRPETGTTFAGNACVAMPHKIGRIIEGSPADRCGKLKVGDRILAVNGCSITNKSHS
DIVNLIKEAGNTVTLRIIPGDESSNASLLTNAEKIATITTTHTSQQQAAPEASPRNTKPK
QESFEFKAPPGPPPQPPQQVSAQDAEFYSVDLERDNKGFGFSLRGGREYNMDLYVLRLAE
EGAAVRNGKMRVGDEILEINGESTKGMKHARAIELIKSGGRRAHLVLKRGDGSVPEYGGS
IYENIPFSPIFTP
Download sequence
Identical sequences G3P3Z5
69293.ENSGACP00000012318 ENSGACP00000012318 ENSGACP00000012318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]