SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012384 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012384
Domain Number 1 Region: 607-727
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000113
Family Pleckstrin-homology domain (PH domain) 0.035
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000012384
Domain Number - Region: 983-1055
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.000837
Family Regulator of chromosome condensation RCC1 0.053
Further Details:      
 
Domain Number - Region: 208-325
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.00162
Family Regulator of chromosome condensation RCC1 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012384   Gene: ENSGACG00000009374   Transcript: ENSGACT00000012408
Sequence length 1166
Comment pep:known_by_projection group:BROADS1:groupV:11280726:11288964:1 gene:ENSGACG00000009374 transcript:ENSGACT00000012408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVSLLWAVDVYGRVYSLSTAGQVWEQCRDAQMEFKRVTAAQRCCWGIACDNGVYLNVHA
SDLPVRCQEEAYENQRWNPVDGFSDRLLPSDRWQWSDVTGLQHQPLDGFRLPSVSWEWEG
DWHADENLDGEPTEKGGWTYAIDFPATYTKDKKWNSCVRRKRWLRYRRYNVMDSWAKIPS
QQAALPDPFSDISCGGWEISDEPRGRMSLWAVSLQGKVWFREGIDHHNPEGSSWEEMTLP
GEVVQISCGPGDLVWAVLWEGQLIVREGVSRDCPKGTSWAVVDSPSPEVGATHVAVGINV
VWALTKDNKVWFRRGVNSHNPCGSGWIGMVGEMLMINIGLNDQVFAVGREDRAVYFRQGV
TSSELSGKTWRAVTVPRDGDRSHSSASSVQSAGCYFCGEERAPSAVSDVESDTEKGSTDG
SGLLLAAAAVSTEPSADAAPTDPPEARVPKVTSDSFISDLVSDREPATAPWGAAVPEEDL
WSNVDLEEAQGQRDQAGAPADSADTCSLSSLAAYALAAEDQYGADQHPLWAWVSGGGCSV
DSHSQLGWFNCSTTNASPLVQSVQSMSLSVTPAQTAAWRRQIFEQLSERTKREMDNFRHY
EQAVEQSVWVKKGTMQWWRDWRPHKWTDVHFALEQFSGPEGDKDGILFIYYNFNEEKKYL
HAFINEVTILVPVLNDAKHSFAIYSPERTKQRWPIRLAAPTEQEMHDWLALLSDACCSSR
GIQGPPSKQAVWSVTCKGDIFVSEPSPGLEAVPYPTPCDQMFWRQVGGHLRLVESNSVGV
VWGIGYDHTAWVHTGGDGGGFSQGLASSTDNIYTQVDVKSVYIYENQRWNPVTGYTNRGL
PTDRYMWSDASGLHECTKTNMKPPSAQWTWVSDWAIDYGVSGGTDRDGWQYAADFPASYH
GYKTLKDFVRRRRWSRKSKLTTTGPWQEIPPISLIDVSLLPCAAPSGVDVVPLWAISNKG
DVLCRLGVTALTPAGSSWLHVGTDQPFKSVSVGGASQVWAIAKDGSAFYRGSVSPQSPAG
DCWYHIPSPARQKLKQVSVGRTSVFAVDENGNLWYRQGVTPSYPQGSSWEHISNNVRKVS
AGPLDQVWIIADKVQGSLSLSCGTVCHRLGVQPVEPKGQSWDYGIGGGWDHITVRGNSTE
PPRARLPSLTAPAPPAPPAARSAICC
Download sequence
Identical sequences G3P461
ENSGACP00000012384 ENSGACP00000012384 69293.ENSGACP00000012384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]