SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012394 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012394
Domain Number 1 Region: 612-732
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000113
Family Pleckstrin-homology domain (PH domain) 0.035
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000012394
Domain Number - Region: 988-1060
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.000837
Family Regulator of chromosome condensation RCC1 0.053
Further Details:      
 
Domain Number - Region: 218-382
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0011
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012394   Gene: ENSGACG00000009374   Transcript: ENSGACT00000012418
Sequence length 1162
Comment pep:known_by_projection group:BROADS1:groupV:11281436:11288133:1 gene:ENSGACG00000009374 transcript:ENSGACT00000012418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVSLLWAVDVYGRVYSLSTAGQVWEQCRDAQMEFKRVTAAQRCCWGIACDNGVYLNVHA
SDLPVRCQEEAYENQRWNPVDGFSDRLLPSDRWQWSDVTGLQHQPLDGFRLPSVSWEWEG
DWHADENLDGEPTEKGGWTYAIDFPATYTKDKKWNSCVRRKRWLRYRRYNVMDSWAKIPS
QQAALPDPFSDISCGGWEISDEPRGRMSLWAVSLQGKVWFREGIDHHNPEGSSWEEMTLP
GEVVQISCGPGDLVWAVLWEGQLIVREGVSRDCPKGTSWAVVDSPSPEVGATHVAVGINV
VWALTKDNKVWFRRGVNSHNPCGSGWIGMVGEMLMINIGLNDQVFAVGREDRAVYFRQGV
TSSELSGKTWRAVTVPRDGDRSHSSASSVQSAGCYFCGEERAPSARKDPQMAPASSSPPP
PSPQSPQLMPRLRTPPKPASPKSPATASSLTSSLTENQQRPPGAQLSRRRTSSSEKRSQS
GGLGQWSNVDLEEAQGQRDQAGAPADSADTCSLSSLAAYALAAEDQYGADQHPLWAWVSG
GGCSVDSHSQLGWFNCSTTNASPLVQSVQSMSLSVTPAQTAAWRRQIFEQLSERTKREMD
NFRHYEQAVEQSVWVKKGTMQWWRDWRPHKWTDVHFALEQFSGPEGDKDGILFIYYNFNE
EKKYLHAFINEVTILVPVLNDAKHSFAIYSPERTKQRWPIRLAAPTEQEMHDWLALLSDA
CCSSRGIQGPPSKQAVWSVTCKGDIFVSEPSPGLEAVPYPTPCDQMFWRQVGGHLRLVES
NSVGVVWGIGYDHTAWVHTGGDGGGFSQGLASSTDNIYTQVDVKSVYIYENQRWNPVTGY
TNRGLPTDRYMWSDASGLHECTKTNMKPPSAQWTWVSDWAIDYGVSGGTDRDGWQYAADF
PASYHGYKTLKDFVRRRRWSRKSKLTTTGPWQEIPPISLIDVSLLPCAAPSGVDVVPLWA
ISNKGDVLCRLGVTALTPAGSSWLHVGTDQPFKSVSVGGASQVWAIAKDGSAFYRGSVSP
QSPAGDCWYHIPSPARQKLKQVSVGRTSVFAVDENGNLWYRQGVTPSYPQGSSWEHISNN
VRKVSAGPLDQVWIIADKVQGSLSLSCGTVCHRLGVQPVEPKGQSWDYGIGGGWDHITVR
GNSTEPPRARLPSLTAPAPPAP
Download sequence
Identical sequences G3P471
ENSGACP00000012394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]