SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012434 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012434
Domain Number 1 Region: 314-624
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.2e-128
Family Mammalian PLC 0.0000000337
Further Details:      
 
Domain Number 2 Region: 159-313
Classification Level Classification E-value
Superfamily EF-hand 2.67e-42
Family EF-hand modules in multidomain proteins 0.0018
Further Details:      
 
Domain Number 3 Region: 644-769
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.25e-27
Family PLC-like (P variant) 0.000072
Further Details:      
 
Domain Number 4 Region: 34-148
Classification Level Classification E-value
Superfamily PH domain-like 4.76e-24
Family Pleckstrin-homology domain (PH domain) 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012434   Gene: ENSGACG00000009415   Transcript: ENSGACT00000012458
Sequence length 772
Comment pep:known_by_projection group:BROADS1:groupXI:6663507:6677907:1 gene:ENSGACG00000009415 transcript:ENSGACT00000012458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGSGKSAATSTTEHRRKGAETPMDPIRRLGLMDNEDVRGMMQGCNMVKIRSSRWQKRRN
LRLLDDGLTVWCESTKRSRKAKAQQTFAVTEVECVREGCQSEALRRLGGSLPEGKCFTVI
FRGARKSLDLLCPSEEEAQRWVRGLCTLKEHVADMSQKQKLDHWIRSYLRRADDNQDGNM
SYDEVKRLLQMINIDLSEHYALCLFKRCDRSGDGRLDHVEIEEFCRELLRRPELDAVFRH
YSSNGSVLAMAELRDFLGDQGEDASLNHAQSLTLAYELNGWAQKNHFMTQSGFTMYMLSR
ENNVVNPAHARVYQDMSRPLTHYFISSSHNTYLTKDQVTGASSTEPYIRALNQGCRCVEL
DCWDGDKGEPVIYHGHTLTSKVPFKEVIETIAQYAFKASPYPLILSLENHCSLEQQAVMA
KHLRTLLGSKLLTKPLGAQPPQDLPSPEELKGRILVKGKKLIPHLGQSGKGGSCSSFASS
FEDEPVSGSRNTPKKDAAKVCSKLSPELSELVVYCSSVPFRGFENASEKPPNEMSSFSES
EALRLIKDSGKLFVRHNSRQLSRIYPSGQRLQSSNYDPQAMWNGGCQMVALNFQTSGEQM
DLNQGRFLTNGRCGYVLKPDFLCSPASVFDPENTGGGPGHTPTQLTIRILSAQQLPKINT
DKASSIVDPQVSVEIHGVAIDNARNKTHRIDNNGFNPRWDCTLSFQLQVPELALVRFVVE
DHDHNAKNDFVGQFTLPFISLQKGYRHIHLLKADGSSLSPATLFIHVKVTRK
Download sequence
Identical sequences G3P4B1
ENSGACP00000012434 69293.ENSGACP00000012434 ENSGACP00000012434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]