SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012437 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012437
Domain Number 1 Region: 571-860
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-77
Family Protein kinases, catalytic subunit 0.0000428
Further Details:      
 
Domain Number 2 Region: 417-527
Classification Level Classification E-value
Superfamily PH domain-like 1.16e-34
Family Pleckstrin-homology domain (PH domain) 0.00000569
Further Details:      
 
Domain Number 3 Region: 125-198
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.78e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.001
Further Details:      
 
Domain Number 4 Region: 268-327
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.38e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012437   Gene: ENSGACG00000009426   Transcript: ENSGACT00000012461
Sequence length 888
Comment pep:known_by_projection group:BROADS1:groupI:9102134:9126171:-1 gene:ENSGACG00000009426 transcript:ENSGACT00000012461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPGGPSPTGSAVMQPGTPISMPAQGFFPMMDLTPVQGPAGAVVPQQPPTPAGVSFIIQIG
LTRESVLMPLSADLAYVKQMACSIVDTKFPECGFYGIYDKILLFKHDTTTNNILQLVNGA
SDIQEGDLVEVVLSAAATFEDFQIRPHALNVHSYRAPAFCDHCGEMLFGLVRQGLKCDGC
GLNYHKRCAFSIPNNCSGARKRRLSTTSLSSSQSLRLSTTESVYSLGTASSCAEDAGLIR
SHTQMVRPRTPSDARRFYTGRPVHLDKILMSKVKVPHTFAVHSYTRPTVCQYCKRLLRGL
FRQGLQCKDCKFNCHKRCVYKVPNDCLGETIGDMLSPSADPEVPMDYSSEYDASDKSSID
DSDEACSIPGSFSPDNNQDGASGDQSECCLSSSSVYIPLMRVVQSVRQTTRRSSTAIKEG
WMVHYSNKDTLRKRHFWRLDCKCIILFQNNTTNKYYKEIPLSEILEVRPAGNFSLVPTGT
NPHCFELITGTMCYFVGEDPNALPTPNSGIGREVAKAWESVVRQALMPVIFQDAPPAEGN
TTHRQASISISVSNSQIQENVDIGTVYQIFADEVLGSGQFGVVYGGKHRKSGRDVAVKVI
DKLRFPTKQESQLRNEVAILQSLRHLGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSE
KGRLPERLTKFLITQILAALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARII
GEKSFRRSVVGTPAYLAPEVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEEINDQIH
NAAFMYPPNPWKQISPDATDLINNLLQVKMRKRYSVDKSLSHVYLQDYQTWLDLRELETK
LGGRYLTHESDDSRWQMFACQHTLPYPAHLDDEADADVQGLTERVSIL
Download sequence
Identical sequences G3P4B4
ENSGACP00000012437 ENSGACP00000012437 69293.ENSGACP00000012437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]