SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012547 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012547
Domain Number 1 Region: 392-543
Classification Level Classification E-value
Superfamily PH domain-like 2.33e-36
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 
Domain Number 2 Region: 1-74
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000299
Family SAM (sterile alpha motif) domain 0.0011
Further Details:      
 
Domain Number 3 Region: 207-292
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000319
Family PDZ domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012547   Gene: ENSGACG00000009509   Transcript: ENSGACT00000012571
Sequence length 752
Comment pep:known_by_projection group:BROADS1:groupXV:7412280:7430196:-1 gene:ENSGACG00000009509 transcript:ENSGACT00000012571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITSWSEERVGEWLRGLDAPLTQYAVSEWRLSGMDLLQLTCQDLDKLGVHKIGHQELI
LDAVEKLCSLTYGIGSENLHGLTGKLRAVSQTLQKGIQARWRLNSYDGRSTTRLPAAVLQ
IVVELITSAKGLFSLLNRYQFSQLSGYTNSKNIFNNCKELGDIVHKHDTPVYEKEKDIIS
VCRQLVSVCDEILNSSPDGLLTRTAQLERVDLVPVSPGDQLGIEISSTGSSNHFVTGTAV
EPSSEAFLKILAGDEVVQVNDQIVVGWSRANLVKKLRENPSGVTLVLKKIPGLERRRNTT
EEEERSEEEEDEENPRHSIFDRVAASVRSLSFRQVVGRSTSYHGQQGGLSPTAASAGLQS
LESSRLSPGLRRDRSSSPRSPSPFTFGSLRSPSPQGLEQETASISSCPEMVGHTGNKETK
RSTTKGMSTAMSRRRVSCRELGQPDCDGWLWKKRKESHFIAQKWQRFWFVLKGPSLYWYT
SQQDEKAEGFANISSYSIESAGEHKRKYVFKMCHQRFHNFFFAADNVTDMSKWINCLITA
IQKHKKFNTGPDSEEECYSETESESETSPSPRRRNKFYYAPQKVQSHTLPRPKGKTAASV
SSLVTGGSKGSGEAGPVDEMGMMLNNIKEGGVSLIGQEQPFTHDHFRKSFIRRNKNPIIN
EKVHTLRTKQSTLKAKEAELLQINKLLEDSNLSASTYRQWKEQNEELLQEIERTYALEAA
KEADETPAGEFEGAYRLSLSDGEQLVDAEPSD
Download sequence
Identical sequences G3P4M4
69293.ENSGACP00000012547 ENSGACP00000012547 ENSGACP00000012547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]