SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012575 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012575
Domain Number 1 Region: 356-656
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-93
Family Protein kinases, catalytic subunit 0.000000000696
Further Details:      
 
Domain Number 2 Region: 218-288
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.5e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0002
Further Details:      
 
Domain Number 3 Region: 143-214
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.79e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0035
Further Details:      
 
Domain Number 4 Region: 23-122
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.61e-19
Family PLC-like (P variant) 0.0000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012575   Gene: ENSGACG00000009511   Transcript: ENSGACT00000012599
Sequence length 685
Comment pep:known_by_projection group:BROADS1:groupXVII:9686803:9700524:1 gene:ENSGACG00000009511 transcript:ENSGACT00000012599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPFLRIAFNAYDVGVLPGLSEPPICAIKMKESVNTERGKTLVQRKPTMYPAWKSTFDAH
IHEGRVLEVVLMLNAEEPLAKATVGLSVLSERCKKSKTSGHTEFWLDLLPSGKVQMAVQY
FLEETDAAQSQQSVKVSMEDGMTTLNRRRGAVKQPKVHEIKNHEFTATFFNQPTFCSVCR
EFVWGLNKQGYKCRQCNVAIHKRCIEKIIGRCTGTAANSRETMFQRERFKIDMPHRFKTH
NYRSPTFCEHCGSLLWGLYKQGLKCEDCAMNVHANCKKKVANLCGINQKLLAEALLQISQ
KSVKRSDDSNTEDIGIYQGINSATVDPSAIADRKEHEGSGAAPAAPTVPQVRLNINQLVF
HKVLGKGSFGKVLLAELKGQGQYFAVKVLKKDVVLMDDDVECTMVEKRVLALAWENPFLT
HLYSTFQSKEHLFFVMEYLNGGDLMFHIQDKGRFDLLRATFYAAEIIVGLQFLHSRGIIY
RDLKLDNVMLDKDGHIKIADFGMCKERVFGEVRATTFCGTPDYIAPEILLGQKYTFSVDW
WSFGVLVYEMLIGQSPFQGDDEDELFESIRSDTPHYPRWITKEAKNLVEQLFERDPTRRL
GVVGNVRAHAFFKTINWPALEKREVDPPFKPKVKSASDCSNFDREFLSEKPRLSHADKNL
IDSMDQAAFAGFSFINPKLENMITK
Download sequence
Identical sequences G3P4Q2
69293.ENSGACP00000012575 ENSGACP00000012575 ENSGACP00000012575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]