SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012598 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012598
Domain Number 1 Region: 29-119
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.72e-22
Family Ras-binding domain, RBD 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012598   Gene: ENSGACG00000009553   Transcript: ENSGACT00000012622
Sequence length 429
Comment pep:known_by_projection group:BROADS1:groupXIX:10806741:10813865:1 gene:ENSGACG00000009553 transcript:ENSGACT00000012622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPFGKNFLKARQKNRKKTKEAEPVEGKEIQVTVANEDKVVCGVTKHTTCADLIQALLDD
HKSVPESKRLLHGDAKDFCLVEQWKGFERALPPLTRILRLWNAWGDQRPNIQFTLVKTND
FVPQPAKKGAKSRGAKPKRWEHGRAASTQPLPVERQKRVVKKAFRKLEKLHKESSSAAGA
DEIDRMVQLILNQDHAIQDQIRRMRELDLDIEEFEVQMQNEAELQARARGLGAHSDEQLQ
EYLHTSDGVEQLELQVQRHRELIRRLSRDIDAELRANFPQSHYEGGEQEGAAAASWIDSE
PDGSLCAADLEGLRDEVKRSLFAGVSLHSQAAEVEKQLKHYEATLVSKDQECWQLAAQLS
LLQVGDGGGAEGSGPVLPKSETRCGVSQAVKLTPSPADVTDTDSDTGISSTHSQDSLSPC
LDFPLPLDT
Download sequence
Identical sequences G3P4S5
ENSGACP00000012598 69293.ENSGACP00000012598 ENSGACP00000012598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]