SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012604 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012604
Domain Number 1 Region: 75-175
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-31
Family Pleckstrin-homology domain (PH domain) 0.0000625
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012604   Gene: ENSGACG00000009556   Transcript: ENSGACT00000012628
Sequence length 191
Comment pep:known_by_projection group:BROADS1:groupXIII:9383624:9385645:-1 gene:ENSGACG00000009556 transcript:ENSGACT00000012628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CWQVPKSGPAPPRSDVTAVVSATQGGRRQQAYKTEIIGGVVVHTPIQVTKDIKDGGDEMF
QNESEETEGRERKGDRPGVLRCGYCVKQGNVRKSWKRRFFTLDDNAVSYYKSEMDKEPLR
AVPLRDIQKVHECLVKDLLLRDNLFEIITGSRTFYVQTDSPEEMHGWIRDIEMKIQDFRG
PPKVTLSSLFL
Download sequence
Identical sequences G3P4T1
ENSGACP00000012604 69293.ENSGACP00000012604 ENSGACP00000012604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]