SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012640 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012640
Domain Number 1 Region: 150-231
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.38e-19
Family Ubiquitin-related 0.0000954
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012640   Gene: ENSGACG00000009587   Transcript: ENSGACT00000012664
Sequence length 298
Comment pep:known_by_projection group:BROADS1:groupXI:7071721:7073113:1 gene:ENSGACG00000009587 transcript:ENSGACT00000012664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVCALTMLDGMAEEATAAGGVLLLVLALVFAWLSTHVADRGDHILGTILTVGAHASLIG
LGGHDGYSAGSPGADSPEQQAPPPPQENKPDDGEPGPERGEGEAPGEATEGVRTDLLLDI
QSKPPQELGVEDKKILKHIPVLSSIISPTTDRSISVRLKYLNDTEEVAVVEPQDTVGVLK
SKYFSGREHQIKLIYQGQLLQDPKKTLVSLNITQNSVIHCHTTPEEGAQPGAGVSGGLRA
AGVAISTSSLVVPVFVVILAVVWYFRINYRQFFTAPATISLVGVTVFFSFLIFGMHSR
Download sequence
Identical sequences G3P4W7
69293.ENSGACP00000012640 ENSGACP00000012640 ENSGACP00000012640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]