SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012803 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012803
Domain Number 1 Region: 99-230
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.36e-30
Family Cap-Gly domain 0.0000777
Further Details:      
 
Domain Number 2 Region: 11-95
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.92e-22
Family Ubiquitin-related 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012803   Gene: ENSGACG00000009693   Transcript: ENSGACT00000012827
Sequence length 241
Comment pep:known_by_projection group:BROADS1:groupI:9571378:9575322:-1 gene:ENSGACG00000009693 transcript:ENSGACT00000012827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMEGEITIVSNPTVNVRLTNTISSFESMRRFNRGITIAELKGKLEMIVGASPSSMELELF
SVSDIFLQKMDDNEALLGSYPVDDNCKIHVIDKSGQISEFTDVSKVEKFELPDDAYEKRT
DSARSFMKKHGVGQFNEEEKAKKRAENAARRFKSCLTIKKSSLCIVVPGVKNNVVPFFAG
TTDFKPGYWVGVKYDEPLGKHDGSVAGKRYFECENKYGGFVKPFSVTVGDFPEETYDLDE
M
Download sequence
Identical sequences G3P5D0
ENSGACP00000012803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]