SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012815 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012815
Domain Number 1 Region: 98-234
Classification Level Classification E-value
Superfamily Cap-Gly domain 2.09e-38
Family Cap-Gly domain 0.0000243
Further Details:      
 
Domain Number 2 Region: 10-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.92e-22
Family Ubiquitin-related 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012815   Gene: ENSGACG00000009693   Transcript: ENSGACT00000012839
Sequence length 245
Comment pep:known_by_projection group:BROADS1:groupI:9571456:9575293:-1 gene:ENSGACG00000009693 transcript:ENSGACT00000012839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGEITIVSNPTVNVRLTNTISSFESMRRFNRGITIAELKGKLEMIVGASPSSMELELFS
VSDIFLQKMDDNEALLGSYPVDDNCKIHVIDKSGQISEFTDVSKVEKFELPDDAYEKRTD
SARSFMKKHGVGQFNEEEKAKKRAENAARREEEKAAADALSVGSRCKVQVPEQPTKLGTV
MYVGTTDFKPGYWVGVKYDEPLGKHDGSVAGKRYFECENKYGGFVKPFSVTVGDFPEETY
DLDEM
Download sequence
Identical sequences G3P5E2
ENSGACP00000012815 69293.ENSGACP00000012815 ENSGACP00000012815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]