SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012826 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012826
Domain Number 1 Region: 4-118
Classification Level Classification E-value
Superfamily PH domain-like 0.000000273
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012826   Gene: ENSGACG00000009727   Transcript: ENSGACT00000012850
Sequence length 135
Comment pep:known_by_projection group:BROADS1:groupXII:12103970:12104374:1 gene:ENSGACG00000009727 transcript:ENSGACT00000012850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFPAKVMRDGQLEKRSSGLLQLWKKKRCALTEDGLRLRDCKGGGDAAAPTFAWSSKAKE
LRFERMATVDCVEYKRGLVYFTVVMATGKEIDFRCPQEGTAWNAEIALALVRYKNLQAVQ
TGRNRRLSGAHLGST
Download sequence
Identical sequences G3P5F3
69293.ENSGACP00000012826 ENSGACP00000012826 ENSGACP00000012826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]