SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012881 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012881
Domain Number 1 Region: 120-312
Classification Level Classification E-value
Superfamily PH domain-like 8.66e-32
Family Pleckstrin-homology domain (PH domain) 0.0081
Further Details:      
 
Domain Number 2 Region: 9-98
Classification Level Classification E-value
Superfamily EF-hand 0.000000338
Family Calmodulin-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012881   Gene: ENSGACG00000009748   Transcript: ENSGACT00000012905
Sequence length 596
Comment pep:known_by_projection group:BROADS1:groupXIX:11098549:11111043:-1 gene:ENSGACG00000009748 transcript:ENSGACT00000012905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSSLDLIMALRDELLKSIWHAFTSLDVDKSGKVSKSQLKVLSHNLCTVMKIPHDPVALEE
HFKDDDEGPVSNQGYMPYLNRFILDKVTGNFDLQDFNKMCWTLSFRKNLDQSLLLISNDD
AFKIWCIFNFLSEDTYPLTVVTEEIDRKTKYETDGGMGGSWVEERFEDYKLQLDSRQQSL
SAWQLIGLVGSGHFSKGMERQTLSMGVNEVYQELIMDVLKQGYMMKKGHKRKNWTERWFM
LKPNSISYYVGEDLAEKKGDILLDRNCDVEPLPDKDGKKCLFLIKSSQKTFEISVSDKKK
KHEWILAIQTCVSLLRQCRPAPHREARQRRRDLRLKLRAEQEELQLRMKELQLANEAKQL
ELENMRKALEEAATNAAEEEQRRLQTQTELQDRYQTDLEREQMVRKEMEKQVAQKSTELE
QYLQRVREMEGMYRQLEDALEDEKRARQEEEAVRKLQARLLEEEATKRVELEEFHLRQQR
AISQTEAEKRELEKERVAKESALQAAMTQLEQLEQERQGALEQYQTVMKKLEDATNNTKT
WKHKVAEHEGMLRLIQPGSKGQQMITNWGPAAFSDAELTLRQKKWQEGKNQTAEAQ
Download sequence
Identical sequences G3P5K8
ENSGACP00000012881 ENSGACP00000012881 69293.ENSGACP00000012881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]