SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013007 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013007
Domain Number 1 Region: 337-507,543-628,657-685,745-852
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.16e-81
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00097
Further Details:      
 
Domain Number 2 Region: 191-299
Classification Level Classification E-value
Superfamily RING/U-box 3.41e-35
Family Zf-UBP 0.00000427
Further Details:      
 
Domain Number 3 Region: 708-763
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000234
Family UBA domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013007   Gene: ENSGACG00000009840   Transcript: ENSGACT00000013032
Sequence length 854
Comment pep:known_by_projection group:BROADS1:groupXX:11551799:11561822:-1 gene:ENSGACG00000009840 transcript:ENSGACT00000013032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEPRGGGDGADGGERGGTKLVMAEVGEVLMSVLSTIRVPKPGDRVHKDECALSFSSPESE
GGLYVCMNTFLGFGSQYVDRYHARTGQRAYLHITRIRKAKKEDDNSSGSGHPPKKKPTRL
AIGIEGGFDVEQELYEEDVKVVILPDRQEVTSEDLATMPDVVSLSMAGIMAADSVSHALQ
VQQWDGEVRQESRHAADLKQLDNGVKIPPSGWRCEVCDLQENIWMNLVDGKLLCGRRYFD
GSGGNNHALLHFRETGYPIAVKLGTITPDGADVYSYDEDDMVLDSKLPEHLAHFGINMMT
MEKTERTMTELEIAVNQRVGEWEVIQESGTTLRPMFGAGLTGMKNLGNSCYLNSVMQVLF
TVPDFQNKYVSNIDKIIDEAPSDPTQDFKTQVAKLGYGLLSGEYSKPAPDPADENGASEP
RGDQIGIAPRMFKALVGRGHAEFSTNRQQDAQEFLLHFINMVERNCRSGSNPSEAFRFLV
EERIVCQQSQKAKYTQRVDYIVQLPVPMDQATNTEELQEAERRREEGDSSAPTVRAQIPF
TACMAALSEPEILTDFWSSAVQSKTTATKTTRFASFPDHLVIQIKKFTFGLDWVPKKLDV
SIDVPDTLDLSALRATGQQPGEELLPEVAPPPLMTPDVEKAFVSWDLSYSILDDSTVSQL
CEMGFPLEACRKAVYYTGNTGIDAAMNWIMSHMDDPDFAAPLVLPGCSSGPGTTPTESLS
EEHLATIVSMGFSRDQATKALRATSNVLERAVDWIFSHLDDLESMDVSEGGRSAAESEGG
RDPPPPGPRVKDGAGKYELFAFVSHMGTSTMCGHYVCHIKKDQQWVIFNDQKVCASEKPP
KDLGYLYFYRRVAE
Download sequence
Identical sequences G3P5Y4
69293.ENSGACP00000013007 ENSGACP00000013007 ENSGACP00000013007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]