SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013090 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013090
Domain Number 1 Region: 135-339
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-54
Family DBL homology domain (DH-domain) 0.0000797
Further Details:      
 
Domain Number 2 Region: 359-479
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000156
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013090   Gene: ENSGACG00000009911   Transcript: ENSGACT00000013115
Sequence length 520
Comment pep:known_by_projection group:BROADS1:groupXII:12398167:12402903:1 gene:ENSGACG00000009911 transcript:ENSGACT00000013115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVDETGETWTSCAAMLETHSIPCDHAGKKRKQDPEPVVRIIEDDEEEDEEGEMMSDHMR
DSEEPSNKRVKPVAKSNSLTGVLTPVKTPALKRIGQSISRSISFRTEARPLPPAPLRSRS
KASSYPRRRNSQCWSDTVESHDLTVKEIKRQEVIYELTQGERQLIDDLSLVKKVYYEPML
KLEIMTKPELGQIFGTLDSLIPLHQDLLGRLERLRGSGKTIGQVGPTLMNWFPCLEAYVT
YCRNQVGAKALLDQKKHEKKVEHFLRLCQESSFSRKLDLWNFLDLPRSRLVKYPLLLKEI
QKCTPPEHPDEDTLPDALELVQSIVAEVNKNTGEAECQFYRQGLVYLEDGQRLQEIQLSR
FLYCHGELKNNKGQRLHVFLFELALVLTRPGEDRDRGQVFHVYRQPLPNALLNLEEIPDG
EPGGGGTFRGAFTGGSDKVKNCFRVSSRGRSKFHPYSLQANDSFSRQQWITCLRQAIVQS
RDRTAQTSQSQLSLHADPAVYHIAQLSLSSDTEMADHTCR
Download sequence
Identical sequences G3P667
69293.ENSGACP00000013090 ENSGACP00000013090 ENSGACP00000013090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]