SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013091 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013091
Domain Number 1 Region: 6-144
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-47
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000000477
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000013091
Domain Number - Region: 213-292
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 0.00366
Family Tubulin chaperone cofactor A 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013091   Gene: ENSGACG00000009905   Transcript: ENSGACT00000013116
Sequence length 362
Comment pep:known_by_projection group:BROADS1:groupXIII:9687499:9704517:1 gene:ENSGACG00000009905 transcript:ENSGACT00000013116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTITMGEQPIYSTRAHVFQIDPNTKKNWLPTSKHAVTVSYFYDSTRNVYRIISLDGTKA
IINSTISPNMTFTKTSQKFGQWADSRANTVYGLGFSTEHHLAKFAEKFAEYKEAARLAKE
KSQEKMEMATSPSQESPGGELSSPLTPVTPPMESINGSDDMCDTTPNSDTRPEPSQNALA
FAHSPAMTKHWEAELEALKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTEL
ECQSNQMPVIKSQKTELNQTIEELENTLRDKEEEMEKLKEELENMNDLMEQKDTLTQKLE
ETELRGRVLEEQLMGAEQRLEDNQEEQENFRKSLRTLLELLDGKIFELTELRDTLARLIE
EA
Download sequence
Identical sequences G3P668
ENSGACP00000013091 69293.ENSGACP00000013091 ENSGACP00000013091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]