SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013096 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013096
Domain Number 1 Region: 120-324
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-54
Family DBL homology domain (DH-domain) 0.0000797
Further Details:      
 
Domain Number 2 Region: 344-464
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000148
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013096   Gene: ENSGACG00000009911   Transcript: ENSGACT00000013121
Sequence length 505
Comment pep:known_by_projection group:BROADS1:groupXII:12398273:12402883:1 gene:ENSGACG00000009911 transcript:ENSGACT00000013121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVDETGETWTSWYGLTFETTMLSAARNDDEEEDEEGEMMSDHMRDSEEPSNKRVKPVAK
SNSLTGVLTPVKTPALKRIGQSISRSISFRTEARPLPPAPLRSRSKASSYPRRRNSQCWS
DTVESHDLTVKEIKRQEVIYELTQGERQLIDDLSLVKKVYYEPMLKLEIMTKPELGQIFG
TLDSLIPLHQDLLGRLERLRGSGKTIGQVGPTLMNWFPCLEAYVTYCRNQVGAKALLDQK
KHEKKVEHFLRLCQESSFSRKLDLWNFLDLPRSRLVKYPLLLKEIQKCTPPEHPDEDTLP
DALELVQSIVAEVNKNTGEAECQFYRQGLVYLEDGQRLQEIQLSRFLYCHGELKNNKGQR
LHVFLFELALVLTRPGEDRDRGQVFHVYRQPLPNALLNLEEIPDGEPGGGGTFRGAFTGG
SDKVKNCFRVSSRGRSKFHPYSLQANDSFSRQQWITCLRQAIVQSRDRTAQTSQSQLSLH
ADPAVYHIAQLSLSSDTEMADHTCR
Download sequence
Identical sequences G3P673
ENSGACP00000013096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]