SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013172 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013172
Domain Number 1 Region: 16-142
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000904
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013172   Gene: ENSGACG00000009977   Transcript: ENSGACT00000013197
Sequence length 408
Comment pep:known_by_projection group:BROADS1:groupX:15330083:15338731:-1 gene:ENSGACG00000009977 transcript:ENSGACT00000013197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKSNQRGRDSGQPAVQQPEKVGWIRKFCGRGIFRELWRNRFVVLRGDHLYVSDKEVRDE
RRAQEVFNLADYERSEELRKAKSRSKKNHSRFTLLRCRHPGNMVPNLVFLAVSPEEKESW
VHALNVAIIKAKNRVLDEVTIEEDSALVHPTRDRVKIPYGRRLPTRGHLMAVASTSSHGM
LTLDLVAEEDAFCPDSESWENFQVDPRWGGSCGQVASIGSWGVGVRQRAGTDVSKLRATP
KEPTVLKAQSQTPQPGKRFSMQGRSRCASMDEVLSSRLRSALRRCPTEEEEAGGGVSVVQ
PVGQLQSLIAQRMQRAQELLEEMSLTLTSGGSFKSLPPKTEGDPEVERRREEAGRLLEEA
VSSWKEAQEVLQEVKELQSQTLRRQRRRTYEKMSLTQRCQHLYKRELF
Download sequence
Identical sequences G3P6E9
ENSGACP00000013172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]