SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013176 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013176
Domain Number 1 Region: 20-145
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000118
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013176   Gene: ENSGACG00000009977   Transcript: ENSGACT00000013201
Sequence length 442
Comment pep:known_by_projection group:BROADS1:groupX:15330148:15338655:-1 gene:ENSGACG00000009977 transcript:ENSGACT00000013201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKSNQRGRGLQDSGQPAVQQPEKVGWIRKFCGRGIFRELWRNRFVVLRGDHLYVSDKEV
RDERRAQEVFNLADYERSEELRKAKSRSKKNHSRFTLLRCRHPGNMVPNLVFLAVSPEEK
ESWVHALNVAIIKAKNRVLDEVTIEEDSALVHPTRDRVKIPYGRRLPTRGHLMAVASTSS
HGMLTLDLVAEEDAFCPDSESWENFQVDPRWGGSCGQVASIGSWGVGVRQRAGTDVSKLR
ATPKEPTVKTSSLPRGSELSWGKQSHPEASKVLKAQSQTPQPGKRFSMQGRSRCASMDEV
LSSRPAMIRSELRSALRRCPTEEEEAGGGVSVVQPVGQLQSLIAQRMQRAQELLEEMRLQ
PGSSKESPCSRSFKSLPPKTEGDPEVERRREEAGRLLEEAVSSWKEAQEVLQEVKELQSQ
TLRRQRRRTYEKMSLTYKKKIV
Download sequence
Identical sequences G3P6F3
69293.ENSGACP00000013176 ENSGACP00000013176 ENSGACP00000013176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]