SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013224 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013224
Domain Number 1 Region: 396-614
Classification Level Classification E-value
Superfamily Bet v1-like 1.65e-38
Family STAR domain 0.005
Further Details:      
 
Domain Number 2 Region: 5-112
Classification Level Classification E-value
Superfamily PH domain-like 9.97e-22
Family Pleckstrin-homology domain (PH domain) 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013224   Gene: ENSGACG00000010013   Transcript: ENSGACT00000013249
Sequence length 623
Comment pep:known_by_projection group:BROADS1:groupXIII:9787268:9800654:-1 gene:ENSGACG00000010013 transcript:ENSGACT00000013249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEKSSSSGSDEDVDPESAQHVELGGVLSKWTNYIHGWQDRWVVLKNNTLSYYKSEDERE
YGCRGSLCLRKAVITPHEFDECRIDISVNDSVWYLRAEDPEHRLQWIESIELHKAESGYG
SETSLRRHGSMLSLTSAASALSATSTSSFKKGHRLREKLAEMETFRDILCRQVDTLQKYF
DSCADVVSKDEFQRDREVEEDEEDFPTTARPEGEHNHNNNGSKEKLFSPASPKTMNGIDF
KGEAITFKATTAGILSTLSHCIELMVKREDSWQKRVDKELEKRRRVEDAYKSAMNELKKK
SHYGGPDYEEGPNSLINEDEFFDAVEAALDRQDKIEEQCQSEKVRIPRLTPVPPGDVYSS
IGTHRFAAKPHSHSSSLSSVELVSASDDIHRFSTQVEEMVQNHMTYSLQDVGGDANWQLV
IEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHELCHYFWDTAVRMDWETTIENFNVV
ETLSDNAVIVYQTHKRVWPASQRDVLYLSAIRKILATNENDPDTWLVCNFSVDHDNALPT
NRCVRAKINVAMICQTLVSPPEGDKEISRDNILCKITYVANVNPGGWAPATVLRAVAKRE
YPKFLKRFTSFVQEKTAGKPILF
Download sequence
Identical sequences G3P6K1
ENSGACP00000013224 ENSGACP00000013224 69293.ENSGACP00000013224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]