SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013228 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013228
Domain Number 1 Region: 121-270
Classification Level Classification E-value
Superfamily PH domain-like 9.44e-38
Family Pleckstrin-homology domain (PH domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 9-46
Classification Level Classification E-value
Superfamily WW domain 0.0000000108
Family WW domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000013228
Domain Number - Region: 56-90
Classification Level Classification E-value
Superfamily WW domain 0.000384
Family WW domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013228   Gene: ENSGACG00000010014   Transcript: ENSGACT00000013253
Sequence length 1145
Comment pep:known_by_projection group:BROADS1:groupXIX:11517961:11572275:1 gene:ENSGACG00000010014 transcript:ENSGACT00000013253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADIQPEWISGLPSSWSYGVTRDGRVFFINEEAKSTTWLHPVRGEALITGHRNTPATDL
PTGWEEGYTFEGARCFINGTNDRKVTFEHPVPNLFPQDNCIFVVHKKSASKVPANEKKDR
PLSTMTEASNYTGSSDFAANPTNTAERPSRPSKKIHNFGKRSNSIRRNPSAPVIRRNWLY
KQDSTGMKLWKKRWFVLSDLCLFYYRDEKEEGILGSILLPSFRVSMLSVDDHINRKYAFK
ATHPNMRTYYFCSDTAKEMEAWMKVMTDAALVHSEPVKRLDRLKVEQCGPQEINHVADHR
PPLTQPEIHNNQLNREVDRERAPEASPAAADDERKQRDAERYGFQQDGAERGRPLTKINS
VKLQPAQAAAVKAGVASPQPPTEVDGSHRGPQVNGSGEHAAQDRTAVPPRRSPTPEPDRA
LSRTSSMQQLEHWVRTQRGRNQDDDTRSITSYQTLPRNMPSHRVPYMPHYGDGYSSMPRN
SMAQRDSLCSMSPSLYEQALGPSPVDNRRSMRDDTMWQLFEWQQRQAYTRPPPPGLYRDM
ASPKTMINLSEHAAPSHSIPPSPSHGSLSMYGGYSPMRSYVSGAHSEVSSPVYRGDASID
RRVRPQHNKYAYPPDRRSMPAGIPVQTISAQSLHGKTLGPEDYRDLAYARAAEEVDIDTK
LSRLCEQDKVVRTQEDKLKQLYREKHTLETALLSASQEIEMGSESPAAMQSVIQQRDLLQ
SGLLSTCRERSRIAAELELSWREYEKLEGDVALAKNDLLEQLEALGSPQTEPPSQQHVRI
QKELWRIQDVMEALSNHKAQREADGMSLHEPMTNFSKNKNEGPDYRLYKSEPELTTVAEV
DESNGEDRSEHPSDREHSGNKGSYPVGIVPPRTRSPVTDSSSIASYVTLRKSKRPDPKAE
RPRSALEQQLCAAESGRPRMSVEEQLDRIRRHQQGALREKKKGAHVRGAGQENTPSRSHS
FTKENHYRAQSQMRRREEGICCIDELEASLRLQEVVRDQETPAEEIARLKEASQDDHLNM
DRELSVPDKVLIPERYVESDPEEALSPEQEADKQRKVDRIKALIAKNSMQNALPSMALSP
EEETEVEVTVQEKEKMINISYELAAEASKRSKLVAVNRLSSSSSPLPQPSNTPPQLPDGS
HFMCV
Download sequence
Identical sequences G3P6K5
69293.ENSGACP00000013228 ENSGACP00000013228 ENSGACP00000013228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]