SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013232 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013232
Domain Number 1 Region: 332-504,544-629,658-686,757-866
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.55e-79
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0016
Further Details:      
 
Domain Number 2 Region: 186-294
Classification Level Classification E-value
Superfamily RING/U-box 5.3e-32
Family Zf-UBP 0.00000503
Further Details:      
 
Domain Number 3 Region: 715-772
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000107
Family UBA domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013232   Gene: ENSGACG00000010015   Transcript: ENSGACT00000013257
Sequence length 869
Comment pep:known_by_projection group:BROADS1:groupVIII:12640083:12660820:1 gene:ENSGACG00000010015 transcript:ENSGACT00000013257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRCRAAPRHCGARSRNAKMAADLGELLVPYMPTIRVPRTGDRVYKSECVFSFDSPESEGG
LYVCMNTFLGFGREHVERHYRKTGQSVYMHLKRHVKEKATGAAAGAVPRRRNGKVFLDLE
LNRDFNGEDYEYEDEAKLVIFPDHFEIPLPNIEELPALVTIACDAVLNAPSAYKKQELES
WEEEIQVSRHARSLRQLDNGVRIRPSGWKCQKCEMRENLWLNLTDGAVLCGKWFFDGSGG
NGHALDHFKETKYPLAVKMETITPDGADVYSFEEEEAVLDPHISEHLSHFGIDMLQMQKK
TENGHHTDNNSRPRVSEWEIQESGMKLKAVFGSGYTGVKNLGNSCYLGTVIQVLFSIPDF
QRMYVGNLQRIFDYSPLDPSQDFATQMAKLGHGLLSGLYSKPPMKSELIEQVMKEGHKHQ
QKGVSPRMLKALVSRGHPEFSSNRQQDAHEFLQHMVNLVERNSAGSENPSDVFRFLVEER
VQCCQTRRVRYTQRVDYCIQLPAPIEAATNREELVAYETKRREAEENMQAPPDPVTARIP
FTACLQAFTEPENVPDFWSSALQAKSAGVKTSRFSSFPEYLVLQIKKFTFGVDWVPKKLD
LAIDVPDFLDLSRLRATGLQTSEEELPDLLPPIVLPEDTRGTEQGTLLVAPEIDEAAVMQ
LAEMGFPLEACRKAVYYTGNMGPEMAFNWIIAHMEEPDFAEPLTLPSEALMDPGPSTSES
PMGGTPPGNSPPEESISILTSMGFPRAHSIQALKATNNNLERALDWIFIHPEQQEEESDA
LSDEADTQPNDNAFSNDRGASGPRVKDGPGRYELFAFISHMGASTMSGHYVCHIKKEGRW
VIYNDHKVCLSERPPKDLGYIYFYHRLSS
Download sequence
Identical sequences G3P6K9
ENSGACP00000013232 ENSGACP00000013232 69293.ENSGACP00000013232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]