SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013239 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013239
Domain Number 1 Region: 9-124
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.16e-24
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013239   Gene: ENSGACG00000010022   Transcript: ENSGACT00000013264
Sequence length 232
Comment pep:known_by_projection group:BROADS1:groupXVIII:9704079:9706881:-1 gene:ENSGACG00000010022 transcript:ENSGACT00000013264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLNALQALERESVLDVLRRDKQLRAIEEARIRRMKSELQELRRRGAKSFSRQYGERTCA
RCQRPLGKFWNSGAVCDGCSHRICRKCRVGVGATGWKCTVCHAYRDVKFRSGEWFLEQRA
KKFPVTTDKYEMVGEKILKRYNVLSHISIVPPTPPPYMDMQFPSRSGDLKNSKPFTKSME
DLMVSFTSHIRKISTSQSDVRGDLLRVGDNRRESAFNYTTQKSLSDTDISKS
Download sequence
Identical sequences G3P6L6
ENSGACP00000013239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]