SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013240 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013240
Domain Number 1 Region: 148-260
Classification Level Classification E-value
Superfamily Bromodomain 1.7e-28
Family Bromodomain 0.00039
Further Details:      
 
Domain Number 2 Region: 267-398
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.85e-22
Family PWWP domain 0.0086
Further Details:      
 
Domain Number 3 Region: 78-132
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000555
Family PHD domain 0.01
Further Details:      
 
Domain Number 4 Region: 1076-1119
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000331
Family MYND zinc finger 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000013240
Domain Number - Region: 978-1077
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.000981
Family Apolipoprotein A-I 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013240   Gene: ENSGACG00000010012   Transcript: ENSGACT00000013265
Sequence length 1177
Comment pep:known_by_projection group:BROADS1:groupXVII:10282021:10292562:-1 gene:ENSGACG00000010012 transcript:ENSGACT00000013265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEISTRSKDGGSTERVTQKRKMPSPARSSNGHSSAETSPCPVKKKKKPGAVSSSKDQSEL
RHGPFYYVKQPALTTDPVDVVPQDGRNDFYCWLCHREGQVLCCELCPRVYHAKCLKLPAE
PEGDWFCPECEKITVAECIETQSKAMMMLTIEQLSYLLKFALQKMKQPGTEPFQKPVSLE
QHPDYAEYIFHPMDLCTLEKNIKKKMYGCTEAFLADAKWILHNCIIYNGGNHKLTATAKV
IVKICEHEMNEIEVCPECYLSACQKRDNWFCEPCSNPHPLVWAKLKGFPFWPAKALRDKD
GQVDARFFGQHDRAWVPLNNCYLMSKEIPFSVKKTKSIFNSAMQEMEVYVENMRKKFAVF
NYAPFRTPYTPDNNFQMLLDPSNPSSTPIKPDKQEKIKLSFDMTASPKISLARTMLSGAG
VGGSAAGRRLPLSDMPRSPMSTNSSAHTGSDGETETADKSQTKAPNSQYSTGEESMDCTA
SPAHPRPCPAGSSLDSPKPFHSQAPGGPKQEKTPPTGSILNLNLDRSKAEMDLKELSETV
QQKQGATPVLTSPKRQIKSRFQLNLDKTIESCKAQLGIDEISVDVYKGVEHSDSEDSDKS
DSSDSEYASDDEQKTKEAEDAAPSDEAQKDSAKSKAKDQPSPSQEEGEADSHVASETTAG
DGSASASDAPTRAQASTGCEKESPEKTKAPPASPSLRERAHGKEEAKQAVPVEDSDSERE
LVIDLGEEQGAKDRKRSRKDNASVKEASAAKTEGKAVTTSTLPSQNSTAPSTPPSASTQS
PIAVPVTMVSFTTPSPATISLANVSGATATPPSSSSSASATPALKKQRPLLPRETVPVVQ
RAVVWNPGAKFQTSSQKWHMQKVQRQQQNQQPAGEAQAPASSPGQGQAQAPTQTQAAGTG
SAAVSSSSAQQSSQSARYQTRQAVKAVQQKDAPLSTSTSAVTLVSGSPSAVAMMATAATS
SPVATDLYIPTASADAAADIAKYTNKIMDAIKGTMNEIYNDLSKSTSGNTIAEIRRLRIE
IEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERERLVSEVKKQMELEKQQAVDETKKKQ
WCANCRKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSASAPQQESEAESTADLPNKGL
GQTSSGPSSLVVQGPACLSDKDCDTEKSTDAAPVTLS
Download sequence
Identical sequences G3P6L7
69293.ENSGACP00000013240 ENSGACP00000013240 ENSGACP00000013240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]