SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013318 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013318
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 9.32e-17
Family MBT repeat 0.01
Further Details:      
 
Domain Number 2 Region: 597-656
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000177
Family PHD domain 0.0062
Further Details:      
 
Domain Number 3 Region: 87-134
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000401
Family Tudor domain 0.017
Further Details:      
 
Domain Number 4 Region: 391-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000491
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013318   Gene: ENSGACG00000010085   Transcript: ENSGACT00000013343
Sequence length 975
Comment pep:known_by_projection group:BROADS1:groupXVII:10425951:10434898:1 gene:ENSGACG00000010085 transcript:ENSGACT00000013343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKTPPNRRGISFEVGAQLEARDSHKNWYAANIERVDYEGEKVLIHYRQWSHRYDEWFEW
TSPYLRPVERVQLRRQGLNDDAGEPGFHVNDKVLASWSDCRFYPAKVISVNKDASYTVKF
YDGVIQTVKGIHVKPFIKEGGKPRSSERTMVRRAPNRRDRRPQENGGPKNKRARRSTSDQ
EEDSNSEDEERDERTVNEKNKKANGEVGAAPTVKQEEEISVQAEPNEPADVEKGAGLTNG
VKVEEDGDEPTEEKCLLNGEVKKEEVETEQSGTKPYTASPKPYTELPTQTPAQMEQGPVT
MTTAESNGDAEQKPSGQSESAQPAADVPPPKPVKRNRVSTTPTDSAENHVSTTPRVEPSF
AFCAVRFLYAPLLVSVYRVIKNQPPPVLSINLDHNPFKCSAPGCTKSFRKAKLLHYHMKY
YHGEEQPAEGEHSPTRSVQTRASEKQAPPAGLEGPKRRRTISASMQSVVPGSAPRGEVKA
AGRRTSAPPAVSTQGHQQRALMREKSKENQLDRNGCQQQQDKDSERSGFDVGSVKEKLKE
KPKQKDFLRIKRKSAFSKLTFCSTYEDSVSDWSTDSCGWSDDDFGVDLDVTTPPLSVDSG
AVDTSDQEIVRCICEVEEENDFMIQCEDCLCWQHGTCMGLLEDNVPDRYTCHICRDPPGQ
RQSLRYWYDREWLSNGHMYGLSFLEENYSHQNAKKITTTHQLLGDVHHVVEILNGLQLKM
SVLQSNTHPDLQLWRQPWKHPERSRSVSCRGTDAAPSPATPDEDMSRGEILMSNALEKLS
SSGSTFPSFQHSYITSEHCYQKPRAYYPAVEQRLVVETRQGSELEDSMRSTEELLEREQR
YGSLLETDKPKSTGTNYKLFIFSSSKRTCISGSHCSAETREEGGRGPGEAADNSRQHQQR
QINLLNHIDSVQDEVSHRMDFIERELDAVLESWLDYTGELEPPDPLARLPQLKQRMKRLL
TQLGKVQQIALYSST
Download sequence
Identical sequences G3P6U4
ENSGACP00000013318 ENSGACP00000013318 69293.ENSGACP00000013318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]