SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013349 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013349
Domain Number 1 Region: 590-617
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000581
Family Ran binding protein zinc finger-like 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000013349
Domain Number - Region: 12-50
Classification Level Classification E-value
Superfamily UBA-like 0.0281
Family CUE domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013349   Gene: ENSGACG00000010107   Transcript: ENSGACT00000013374
Sequence length 619
Comment pep:known_by_projection group:BROADS1:groupVIII:12846546:12851128:-1 gene:ENSGACG00000010107 transcript:ENSGACT00000013374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGGSPLDYHILQDLKQRFPEIPEGVVSQCLLQNNNNLEICCHLLAQESHRYLYGEFHH
SPEDVRLGRNHMLHISMGYPSSEASKARSLVHSNSDSHIEPQRPSYPEPLSAPATMAPSP
GYNPFFMNEQSRSASTPTPPPSIQGMSPTYSPVPRYSMNPITVTIPQNSIPNVPQALQIP
SAHYAMRPSPSQSPQPAPWSSSGVPVYQHQQPPYNTPTYVSPYSSPQHQVQPQPQHQQYV
FLPISSPTLPNMTYHHQQQPQQQPAVYRSYHTKSTLEGPRPRSNSPVHTTHPQGALYMAN
SPSPGSPSRGIPMSGPSCPAAFHPGMYLQHQGPTRPRPASSPQPGQSAYTLKIKVSPGGQ
AQRPLGSPPVAEAESLLNIVDQGGHNAAPAPILPISALPGNIISQFQHMPRRSSSGSDDY
AYTQALLLHQRARMERLKKELLLEKQKLDHLKSNVNSMEYDALQRRFRRVNSTSLIPRPE
EMTRLRSLNRQLQIDIDCTLKETDLLQSRGKFDPKAMNNFYDNIQPGPVVPPKPGKKGNN
HQLTLLQRCRFEFWFKELDALLHSQAVFGFHQTDQGPKPVPEPQRDEDFEGAQWNCESCT
FLNHPALNRCEQCEMPRYT
Download sequence
Identical sequences G3P6X5
69293.ENSGACP00000013349 ENSGACP00000013349 ENSGACP00000013349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]