SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013364 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013364
Domain Number 1 Region: 904-1194
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.75e-87
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000133
Further Details:      
 
Domain Number 2 Region: 111-215
Classification Level Classification E-value
Superfamily Second domain of FERM 3.4e-25
Family Second domain of FERM 0.00069
Further Details:      
 
Domain Number 3 Region: 216-359
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-22
Family Third domain of FERM 0.0099
Further Details:      
 
Domain Number 4 Region: 18-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.26e-18
Family First domain of FERM 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013364   Gene: ENSGACG00000010112   Transcript: ENSGACT00000013389
Sequence length 1198
Comment pep:known_by_projection group:BROADS1:groupXVIII:9930354:9950036:1 gene:ENSGACG00000010112 transcript:ENSGACT00000013389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFRLIMRRTRRYNVLSKNYFVTRIRLLDSNVIECTLSVEATGQECLEAVAQRLELRETH
YFGLWFQGKTQAPPRRWVELEKPLKKQLDKFGNEPLLFFGVMFYVPSVSRLEQEATRRYQ
YYLQVKKEVLDGRLHCTVEQGIRLAGLAVQADFGDFTQFMSQDFLREYVLFPVNWPNGDE
VLEEWTQKVAEEHKSHCRMQTAEAELLYIKEVEKLDGFGQESFPAKDNYTNDIFIGVSFI
GVFVKHRNGRSIMLHKWKDIGTIAHNKSAITVEITSRDDTIIFHMEDMEMAKYIARLFTA
RHKFYKQNKICAEPTHSPVPIRRRPTWTHRPSLPRPQSCNFQSMHSQYGEHYQDTQSSQD
SIFHDDPYYKSETSLDRCQVDFPFRNGTAPNGSMYSSPSLSSLNQSQTFVPASPMSSSLS
IPGSELMRPDYIPSHRHSAIIAPSYRPTPEYDAVMRQKRRMPPAHHDLHSQSLRSLNISN
ACAYRQPEALVYSQPEMRERGPYHGLGPSPGPYGKQGGAAGSQGPCHSPCVNGGEGGGGG
VGSSISHTVSTPELANTKQQGNNAGSSAATANMLRNHMSRPPPPYPSSSFRPATSTPDLA
SHRLRCMGGSSPELVTRMVQLSVKTFQPDSSAVVHQSLQEVSEPLTAAAKHRSTLAKRHS
MEVISSMRGGGGGGLEGIVMKSINLALHRRNTLREHRSSKKSPASSASPAGAYQHQKTLS
NATMLIHSSESEEEEEEEERPELDVQIPGLNEDISISAQLQAALAKLPNKPPPEYPGPPR
PVGNVQTRTHSHNHTQHHNHNPGPGGTLTRGDQGGVNGAVLGPSISEPDLTSVKERVRKE
PVKERPVSELYSLQDSIVEREIAQRTLERQKMSVDSMKRPLMIAALNGLYAARMPEDEGA
KASTDERCKTLELKLEEERVFTEYEQVPKKRADCVVTTATLPENLERNRFRDVVPYEENR
VELVPNKENNTGYINASHIKVMIRGEEWHYIATQGPLASTCADFWQMVWEQGVNVIAMVT
AEEEGGRSKSHRYWPKLGSKHNSATHGKFKVTTKFRTDSGNYATTGLKVKHLLSGQERTV
WHLQYTDWPEQGCPEYVQGFLSYLEEIQSVRRHTNSMLDTSKSLNPPLVVHCSAGVGRTG
VVILTELMISCLEHNEPVEVPTMLSELRQQRVLMVQTISQYTFVYQVLIQFLKNSRLI
Download sequence
Identical sequences G3P6Z0
69293.ENSGACP00000013364 ENSGACP00000013364 ENSGACP00000013364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]