SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013393 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013393
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.13e-29
Family Ubiquitin-related 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013393   Gene: ENSGACG00000010136   Transcript: ENSGACT00000013418
Sequence length 94
Comment pep:known_by_projection group:BROADS1:groupXV:8597128:8599037:1 gene:ENSGACG00000010136 transcript:ENSGACT00000013418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCDRQGLAIRQIRFR
FDGQPINETDTPAQLEMEDEDTIDVFQQQTGGHC
Download sequence
Identical sequences G3P719
ENSGACP00000013393 ENSGACP00000013393 69293.ENSGACP00000013393 XP_010784790.1.77114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]