SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013415 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013415
Domain Number 1 Region: 511-717
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000367
Further Details:      
 
Domain Number 2 Region: 75-346
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.14e-38
Family FCH domain 0.018
Further Details:      
 
Domain Number 3 Region: 459-509
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000015
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013415   Gene: ENSGACG00000010159   Transcript: ENSGACT00000013440
Sequence length 734
Comment pep:known_by_projection group:BROADS1:groupXI:7900410:7907548:-1 gene:ENSGACG00000010159 transcript:ENSGACT00000013440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRYSEIFRDFDNLDLSFISSLLALIIKNTSKTSSLHSVQNEVSMLSGLLQLKQTRMLLPK
GAKEADLALCRCDDGVETALQYTKMWCRYAKDLLGWLEKRISLEQEFAKNVVKAAEGAKA
NVGQQEMMPLQCIYTMALEQDIKNSLSAKKTSELLQNRCHQALAAKKNEIDKWRREFKEQ
WAREQRKMNDAVTLLKKARHQYYQRCDELEKAKAVSAKAVDDTTGMKTLDKRRKSKDEAQ
SKVAEAQFLYKQCVTDVKTHQDDLVKVKEKIIAHIRKLICQGDTVLKEATVNMFYFQRQQ
TESVPLGYHNLESTCRSMEPGEQYMLFVLSKRRPEQPLQVFTFQEYVRPSKGNKRKTSYA
LSSLQDSVPLTDDNPSRRNSDGRRTGHSDSESFGGSLESLSSPDQCMNQAHTNRRLPKTA
STLTVSSDDMDERDVPSESALPTEYIDCPPVKVRTLSQAALTHRLKKMKSKMVKCKQCEN
YIVVHGVECEECGMALHRKCMEVCQQECEQRKGTVFGVDLSLLSGDGVPFVVLLCTSEIE
SRALSVQGVYRVSGSKPRIQKLCQAFEIQKEQVDLSDISPHDIASILKQFFKELPEPLLT
FDLYNDFITVGKNIQHTNESEPTPDTNETMDIVVGLQKLLQRLPPHCYSTLQHMMSHLQR
VSENLENKMSQSNLGIVFGPTLLRPLVSTDMSMLALLETSYQAVVVEFLITHHDKLFGLH
RKPSPPPLPAPAEP
Download sequence
Identical sequences G3P741
ENSGACP00000013415 ENSGACP00000013415 69293.ENSGACP00000013415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]