SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013416 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013416
Domain Number 1 Region: 1-271,414-482
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.87e-81
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000121
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000013416
Domain Number - Region: 528-593
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0382
Family UBX domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013416   Gene: ENSGACG00000010156   Transcript: ENSGACT00000013441
Sequence length 1151
Comment pep:known_by_projection group:BROADS1:groupXV:8609689:8617881:1 gene:ENSGACG00000010156 transcript:ENSGACT00000013441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLKNQGGTCYLNSLLQTLLFTPEFRGKLFSLGAAELGCLEHKENPGAKVRVIPLELQKLF
ASLLLVDQQSASTANLTSSFGWNSSEGTNQHDVQELNRILFSALDHSLVGTTGSTFIHQL
YHGTIVNSIVCKDCGNVSQRQEDFLDLTVCVCGVSSLEEALWNMFVEEELFQGNNLYRCA
HCDRLVTAAKSAKLKKLPPFMTMSLLRFSFDFAKCERYKETGRYSFPLSINLKPFCEETD
AEDSDYSYELFSVIIHKGGCYGGHYHVYIRDIDQLGKWEPPEEEQKPKTQKKSKNEVEQM
CAPILQEDDPLSVITAIIAQEPSKSVLTDQLGQKLMEKIGSSWSKKFRKHYGPIGKFLQS
NNNVFMLVSNGTRVALKANPPSPTTEPPGAAKQATNPDPLTPSDPRAAEQHLDLQQNHWF
DLNDSMVTSIRESDIEKQFQGKESAYMLFYRKTQLHRPSEALHNPQYKIPLNLIQMAQEE
NIQMQKMREEFEATNNTVELRLHLAPSYRLEGGALQPLSKGVAASNALSFDRRKTVGDLR
LAIYQKQELWEGDMALTLAKSLPAGLHLYNTLTDDNVSLYSAGVCTNSDLFVWNGREVCG
ATVLVGAEWEPVLLNVVRPSLGDEGGQEEGDGLQCEEGKGGFENGGPGLKREARGFAGAA
TLGEVREALGEPEESLLCQEHKGGPTGEQGPGEGGGASGWRVFPPDDMQRTLKELSLKDG
DALLVLEPQSFDSSMFARNGDVVTVTTPSDCRWLQVEFGPHGEGGGDGETEEQRKIKVPA
SGNMLLCEVKQRAIEELQLQEQISGAQYCLRHVDCTGKLLPPVCEELSVRAAGVRLMTTL
TLCPGNAPKASQLFLHFSVGAAPSAGMEMDIIVEKTSTVKECLKTMLDVVGLEGTCWHLR
RLDWCEEVGEPIMDEDASLSELKINNGETLVVTQGQLPPKGFLKLSVWLCLDRRNDSEVS
MDFNHTDDGHTQVEAADESPPLGVGNMAEPRRAGPVEISDEATLEDLKAQVLTLPALQDV
CVPTTAFLRVWQLEGRRLARILRGGQLTLKKLKLSSGTDLCVQQLLKEEDLGPKDVMLNV
KMGVPGERCFYPPEELVWDAARDSSPRSLRTRLAAHFCLSPDSLLLAKHQPDKHAWEEIS
NWNQQVSKKKK
Download sequence
Identical sequences G3P742
69293.ENSGACP00000013416 ENSGACP00000013416 ENSGACP00000013416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]