SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013462 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013462
Domain Number 1 Region: 3-209
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.45e-53
Family DBL homology domain (DH-domain) 0.00027
Further Details:      
 
Domain Number 2 Region: 199-319
Classification Level Classification E-value
Superfamily PH domain-like 6.68e-25
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 3 Region: 372-547
Classification Level Classification E-value
Superfamily PH domain-like 4.06e-21
Family Pleckstrin-homology domain (PH domain) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013462   Gene: ENSGACG00000010186   Transcript: ENSGACT00000013487
Sequence length 549
Comment pep:known_by_projection group:BROADS1:groupXIX:11883603:11891277:-1 gene:ENSGACG00000010186 transcript:ENSGACT00000013487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKSKIHHIATEIMSSESVFVDVLKLLHVDFRDTVSAASRQSGKPVIEERLLNQILYNLPQ
LYELNYDLLRELKQRVAKWDENAQLADIFLKKGPYLKMYSTYIREFDKNVALLDEQSKKN
PAFGAVVREFEASPRCANLALKHYLLKPVQRIPQYRLLLTDYLKNLSEDSVDYKDTEAAL
EIVKAVANHANDTMKQGHNFQKLIQVQCSLSGHHEIVQPGRIFLKEGSLKKLSRKVMQPR
MFFLFNDTLLYTTPVQSSQYKLKSMLSLAGMKVSKPSQEAYQNELNIESVERSFILSASS
ASERDEWLEAISTAITDYTKKKISFISGKPSEVELEDLDDGTPLGSKAPIWIPDLRATMC
MICTCEFTLTWRRHHCRACGKVVCQSCSANKCCLEYLKNQLGRVCDQCFPILQLQKSVQA
ESAALSPGNRATFAFPRKPKKIPAALKEVTASTDNSSMSGYLQRSKSSKKQGKRLWFVIK
DKVLYTYAASEDVAALESQPLLGFELKVDSSHKLEFKLYHKNTLHYIFKADDIQTEQRWI
DSFKEATVL
Download sequence
Identical sequences G3P788
69293.ENSGACP00000013462 ENSGACP00000013462 ENSGACP00000013462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]