SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013467 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013467
Domain Number 1 Region: 2-145
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-28
Family DBL homology domain (DH-domain) 0.00097
Further Details:      
 
Domain Number 2 Region: 147-263
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000032
Family Pleckstrin-homology domain (PH domain) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013467   Gene: ENSGACG00000010195   Transcript: ENSGACT00000013492
Sequence length 264
Comment pep:known_by_projection group:BROADS1:groupXX:11740599:11743112:-1 gene:ENSGACG00000010195 transcript:ENSGACT00000013492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQEVRGTGKPFDPLVLEAGCLQFHERFSSYQHYCWEEENNLKFTRRQMGSNPHFLTYVQ
WVENHPQCERMRLGDMQVKPHQRITKYPLLLKAALKNTQDPHEQHTLRGMLSSVNCFLES
INDHLRLKDEKLALSISAQRVEGYEVERINEDIDKRVREICQFDLTCPISGVGPEVVRKL
LLEENLKIRERKDSKLEVVALLFSDVLLMTKVQKKGDRLKVVRPPLALDRTFCFSLKDDC
SFVVVEVGELRSAMNVYIFVAGTS
Download sequence
Identical sequences G3P793
ENSGACP00000013467 69293.ENSGACP00000013467 ENSGACP00000013467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]