SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013479 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013479
Domain Number 1 Region: 694-964
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-75
Family Protein kinases, catalytic subunit 0.00000587
Further Details:      
 
Domain Number 2 Region: 1699-1982
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.27e-61
Family Protein kinases, catalytic subunit 0.0000227
Further Details:      
 
Domain Number 3 Region: 189-309
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-29
Family Pleckstrin-homology domain (PH domain) 0.0011
Further Details:      
 
Domain Number 4 Region: 2-175
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-24
Family DBL homology domain (DH-domain) 0.00072
Further Details:      
 
Domain Number 5 Region: 311-410
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 6 Region: 590-685
Classification Level Classification E-value
Superfamily Immunoglobulin 3.7e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 7 Region: 401-495
Classification Level Classification E-value
Superfamily Immunoglobulin 1.92e-18
Family I set domains 0.02
Further Details:      
 
Domain Number 8 Region: 1595-1682
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000188
Family Fibronectin type III 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013479   Gene: ENSGACG00000010184   Transcript: ENSGACT00000013504
Sequence length 2015
Comment pep:known_by_projection group:BROADS1:groupVIII:12914092:12928021:1 gene:ENSGACG00000010184 transcript:ENSGACT00000013504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLIQGLIDGEEEFVKSMKMFTSHQLNYLDSSRHVPINILNQREIIFRNIKDIVSLHERSI
LPGLRECATDDDVAVHLIKYAELFEKYLHYMVGQAQAEACLTDKAVQQYFKEMPEPDSDA
PVMDVLTFLQRPAERIQTYQALLKELIKNKAKSGQSCCLLEDTFSMVSCLPWRSDNLHQV
SLIENYPAPLIALGEPVRQGVFTVWEESPEIKTASRGHQRQVFLFKECIVLCKLKRDTSM
NSDTYTFKNKMKLNDVEIKETLGGDERSWGLWHEHRGSVRRYTLQGRSALIKLSWLKDLK
ELQQRSSQPANYPPVFESLLSDAATNIGQTIKLTCKVAGLPKPLVSWLKDGLPLEDDPRH
IITADRSGTFSLILDSVTAEDCGQYACYATSAMGSAGSVATVVVYAPPRFVSRLESACLI
EGEDIQFTCSTLTTPFPRIRWLKDGRELTDQRKYFILNDARSGILCLTVVSTTEADIGQY
ECELSNEFGCIKCKAGLCPAYVPTIDIEEDRPQDLPPKDADSEGWSAAFVKSPTSIAKML
FPPGHPEHHDEAVSASTSVDHVVQQPMCYLEEEEEIYISEQMQEIADAPPSMQVPTEDLC
VEPGQPATFTAIITGRPTPNIQWYKKDGEELAANDNVEISQHGARCSVTIVCPEGEESGI
YTCFAYNDSGHVSCQAELTVVEGPLEFQEREVELGKRRKLFSVYDVHEEIGRGTFGVVKR
VVHRRTGEVFAAKFLPLRSSTRTRSFQERDLLSRLAHPRVACLLDFFCTRRTLVLITEIC
CSHGLLDHLLLKGSVPEREIQSYVQQILEGVGHIHSMNMLHLDIKPDNILMVYPPRDEIK
ICDFGFCQEIDSSRHQYSLFGTPEFVAPEIVHQEPVTVATDIWSVGVIAYICLVGRCPFV
GETDRATLLMVGEGSLNWDAPDVTDRSPEAQNLLHMLLQPDPEKRPSAFECLSHEWFQDE
YAGDDMDEINTKTLKNFISKRKWQRSLTCIGSVLTLRLIPELLEAPLRETAVTVPREPQE
HSSSSRSSGSSSEYDEADSLDFFQHCSPTEEEEDTEEDYDPLIERARIPDLFAKLHIDAE
EETTLGEQSVASSDVSGQQTPQRERRFSRDGGQSLYLSDGEEGSGSDGGRIPRGSVIRST
FYSTSHQLSPMSARHMTLRDKFQAKKQERGRKPLRRSFSGRLNEPLIEYVEDETETSRGQ
RRASVQPPMQKSCSFDSGVGLAHSNVPPHRRSRSLDEYSRRLTSSPKRTMSGEEEGSQSV
KEDVIDDEVAGRNLLAIPSPRRPTRRRGSVAPTQGAGAPRGSSVPSSLFAGDRTGTRLDQ
ERAADDAFAGSQGSLAESSILEHGGSESSSRLGSYEELSHGDLRGRSRSGESEGYDDQGE
PLISGSPCSFQEVKPRSLLPRAPPRNRTRSNPNLYANSRGQPGTPLAASPSLSSLQAPER
PPRAKDKKEGSGLQRHASAPALEVRPPTGRSPRLGLLKIFRRQSWTGHSYSQLDSTELGP
TLGEIMKPDTPTMSLRKKMRASASSLTKLFSRSSSTEDVSKGATGPIVKGSAPIPPERQQ
RTGLESPKKRKLLPSFKIPAFKKSKDLLVRPNKAEVLQLDAGGVLLVWKPVQSSEPVTYC
VQYCTDGAAAWTVLSEEVTESCYVVKDLPRGASYVFRIGCITKTGAGPFSDASAPVVMAT
HPEEIAIPLIQTESLGSKVTGSEQQTTHKNYNFLSEINRGRFSVVNLCRDAETSQVFVAK
ITPYQAEQRQLVLREYQLLKRLHHPHLVQLRTAYFTSRYMVLVEELCPGKELLYSLASRD
LYAETHVAELLVQILSAVDYLHSRRVVHLDLKSDNMLVDDSNHLKIVDLGSAQSFTPGQP
LNIEHIHGLSESKVYIVLPKAPEILDGQGVGPETDIWAIGVLSFIMLSADSPFHAEHSWE
QDRNIKKGKIQFGRCYPGLSEGALSFMKSSLNNKSWGRPTATECLQNPWLRGHRAPHKGR
QSKVCFSTDKLKDYLKQKEEKRDQVRTKLQGPFFQ
Download sequence
Identical sequences G3P7A5
ENSGACP00000013479 69293.ENSGACP00000013479 ENSGACP00000013479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]