SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013504 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013504
Domain Number 1 Region: 592-772
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.49e-45
Family Ypt/Rab-GAP domain of gyp1p 0.0032
Further Details:      
 
Domain Number 2 Region: 750-867
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-27
Family Ypt/Rab-GAP domain of gyp1p 0.0065
Further Details:      
 
Domain Number 3 Region: 3-119
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-21
Family Pleckstrin-homology domain (PH domain) 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000013504
Domain Number - Region: 445-506
Classification Level Classification E-value
Superfamily Tropomyosin 0.0124
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013504   Gene: ENSGACG00000010224   Transcript: ENSGACT00000013529
Sequence length 919
Comment pep:known_by_projection group:BROADS1:groupXIX:11945509:11955675:-1 gene:ENSGACG00000010224 transcript:ENSGACT00000013529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKLCGYLNKLSGKGPLRGYKPRWFVYDPRKCYLYYFKTPQDALPLGHIEIGDACFSYDVE
GEEGQFEIRTTGKEFLMKAPTRQVMHFWLQQLQQKRWEYSNTRGSGQRDSWSSPTLAFPP
TGLVGKDNYAPVFPKQSDGMEKVRSDFAMETESDGGGMVGIQSARGPSATNPLNFSLKNF
GTELRNSMSYLRPGRGAESRRSMFYANSNSSAEEWELVDTPTKDFPEQQKHHTDTHRHSF
GSAFHFDFARTASRPKKPLLRDMMASGRFGRSAETRSAESPPVECNGSRPSDVALRLQSQ
QEELCRMQREQADLRGELASQKELVRLLQQTLRTSQCDRQPVPRRTQQENGQLEALLQER
DGQVQDLCGHMERLALEKESLQQELKGLKIKVGDINDQLGMLMETIQAKDEVIIKLSQES
SEQSATQSDGSPLPVKDQEEMDILKDSLQGYKSQNKFLNKEILELTVLRRNAESREKVLE
AKCTALEAKLCQVESKYLVLLQELKNPVCSSSEQSPAREVISRLLEDALQAESTDHPDHP
IFKPNTVSEYDTFGFKTVPEEEEEEERLVAKVRALELKSLSMTDQEVSIGVKWENYLAST
MNRDLVRSPELKALFRYGVPHEHRSQVWRWCVSFHVKKFRNNLAPDYYETLLNVARDKPN
PASKQIELDLLRTLPNNKHYSSPSADGIQKLRNVLMAFSWRNPDIGYCQGLNRLAAIALL
YLEQEDAFWSLIAIVEVFMPRDYYTKTLLGSQVDQRVFKDLMCEKLPRLHAHFEQYKVDF
SLITFNWFLVVFVDSVVSDILFKIWDSFLYEGPKIIFRFALALFKYKEEEFLKLEDSTAI
FKYLRYFTRTILDSRKLMNIAFGDMNPFPMRQIQNRRSFHLEKVRLELTELEAIRQTFLR
ERETSQERRSFVSDDEEDN
Download sequence
Identical sequences G3P7D0
ENSGACP00000013504 69293.ENSGACP00000013504 ENSGACP00000013504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]