SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013526 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013526
Domain Number 1 Region: 721-1044
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.84e-86
Family p120GAP domain-like 0.0000000000556
Further Details:      
 
Domain Number 2 Region: 345-451
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-27
Family SH2 domain 0.00049
Further Details:      
 
Domain Number 3 Region: 161-262
Classification Level Classification E-value
Superfamily SH2 domain 1.05e-26
Family SH2 domain 0.00045
Further Details:      
 
Domain Number 4 Region: 472-576
Classification Level Classification E-value
Superfamily PH domain-like 1.55e-24
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 5 Region: 599-733
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000753
Family Synaptotagmin-like (S variant) 0.025
Further Details:      
 
Domain Number 6 Region: 273-346
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000289
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013526   Gene: ENSGACG00000010225   Transcript: ENSGACT00000013551
Sequence length 1052
Comment pep:known_by_projection group:BROADS1:groupXIII:10289487:10308628:1 gene:ENSGACG00000010225 transcript:ENSGACT00000013551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMATEVSSEDAGLVTTGVAGGGGPDTAPFTYHTNPSRVRVPDLGQPAAQNPRPNWNPFSG
SLPEMTPTHPLPSGDVTGPGLSAAGSGGAGGGHPPSQGSSSGTVAGGVCHSPTSEGPASR
ISPTRTGPDGPADFPPLPPPPPPPPGCGAPAGTVDESDMQDGPEYEEEEVVFPLSAPPTN
QWYHGKLDRTIAEERLRQARNPGSYLIRESDRRPGSFVLSFLSVTNGVNHFRIIAMCGDY
YIGGRRFSSLSDLIGYYSYVSCLLKEEKLLSPVAPPEPVEDRRRVRAILPYTKVPDTDEI
SFLKGDMFIVHNELDDGWMWVTNVRTEEQGLIVEDLVEEVGREEDPHEGKAWYHGKITKQ
EAYNLLMTVGQVCSFLVRPSDNTPGDYSLFFRTNENIQRFKISPTPNNQYMMGGRYYNSV
DDIIDHYKKEQIVEGYNLKEPVSVQHQEQVLSDTVDGREIYNTIRRKTKDAFYKNIVKKG
YLQFNKGKGKRWKNLYFILEGNDAQLIYFESEKRATKPKGLIDLSVCSVYGVHDSLFGRP
HCFQVVVQHFSEEQYIFYFAGESPEQAQDWMKCLHTFCSNLRKTTQPTSNKRLRQVSSLV
LYVEEAHKLPVKYFNSPYCNIYLNSVQVAKTHPREGQNPVFTEEFIFDDLSSEINRFEIS
LSNKTKKSKESDILFMRCQLNRLQKGQMIDEWFPLSSHVPLKGIEPGSLRVRARYSMEKI
MPEEEYSEFKEMILQKEFHVIYALAHVCGQDRTLLASLLLRIFRHEKAEAPLLRTLNDRE
INVEAPDEATTLFRATTLASTLMEQYMKATATPFVHHALKDTILKIMESKQSCELNPSKL
EKNEDVNLNLAHLLNILSELVEKIFMAAEILPPTLRFIYGCLQKSVQEKWPTNTTMRTRV
VSGFVFLRLICPAILNPRLFNIIADPPSSAAGRTLTLVAKSVQNLANLVEFGAKEPYMEG
VNPFIKNNKHRMIMFLDELGNVPDLPEATEHFRTDLSRDLAALHEVCATHSGELRTLSNE
RGAQQHVLKKLLAITELLQQKQTQYAMSNSNR
Download sequence
Identical sequences G3P7F2
ENSGACP00000013526 69293.ENSGACP00000013526 ENSGACP00000013526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]