SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013570 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013570
Domain Number 1 Region: 417-636
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.8e-49
Family DBL homology domain (DH-domain) 0.0000684
Further Details:      
 
Domain Number 2 Region: 626-782
Classification Level Classification E-value
Superfamily PH domain-like 9.54e-16
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 3 Region: 786-847
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000948
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013570   Gene: ENSGACG00000010268   Transcript: ENSGACT00000013595
Sequence length 867
Comment pep:known_by_projection group:BROADS1:groupI:10510081:10530432:1 gene:ENSGACG00000010268 transcript:ENSGACT00000013595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIGNDVDLSNKNITPLWRPRGDIRQNHHDSSKPKPRPLSCHTNGVMTTDFPVEDNKCSF
TLSQPAERLVVAAPRRGENTVKRSSNIFSMGSRREQKAFGTSSRSSVVNASPVLSQRTPN
NNNNNYNSRELSSLSYASSPSPPARRTPTPSHSSTSSIPSLSSLTSSDPPTPRSPSPADR
GREDRGRAPFRPPPLSPASSQDARHASSSSSISFASLSPSLSPSISPSPSPSVVLSTHSP
AALKMGTQQLIPKGLASDVRQSKAPPPEPQGQGRALKALSMVETGTYFSTGGGHSEGADG
ETESPGTLKRGLRSTSYRRAVVSGVDMEVPSVDANRLSQSVIRWLDEDRTDSPFSPANKK
KLLTTQRTFDKEELYQNYQEKALHNDSDEDADSREAKPDNGIVVQYRPIRTSWSQLSVVK
RSGLSERMTQDERKRQESIFEVISSEHSYLHSLEILIRMFKNSADLSEAMTKTEHHHLFS
NITDVCEVSKNLLSFNKLAMWTHHSIINQSRFTIFSHSLQLFPCVTYCSNEVYQQRTLQR
LVSKNPVFKEVLTRIESHPDCRNLPMISFLILPMQRITRLPLLMDTICQKTPKDSAQYEE
CKKALQAVSKVVRKCNEGARTMERTEMMYTINSQLEFKIKPFPLVSSSRWMVKRGELTAF
VEDSGIFLKRTLRQQVYFFLFNDVLIVTRKKSDESYSVIDYALRDQISVGSCQPQDLNLS
PVRSTASMLSPRQAGANHLFRLRFRSNHSDEKVPMVLGTELLNERARWISALGQNVNSSK
SQDRTNVMQVEVIRTYTAKQPDELSLQVADVVLVSQTVEDGWYEGERLRDGERGWFLAEC
AQPITCQATIERNMQRMDRLQGLETNV
Download sequence
Identical sequences G3P7J6
ENSGACP00000013570 69293.ENSGACP00000013570 ENSGACP00000013570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]