SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013596 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013596
Domain Number 1 Region: 857-980
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.64e-25
Family Ankyrin repeat 0.000000789
Further Details:      
 
Domain Number 2 Region: 4-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.14e-22
Family Ras-binding domain, RBD 0.011
Further Details:      
 
Domain Number 3 Region: 985-1047
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-16
Family SH3-domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013596   Gene: ENSGACG00000010288   Transcript: ENSGACT00000013621
Sequence length 1056
Comment pep:known_by_projection group:BROADS1:groupXVIII:10212268:10230026:1 gene:ENSGACG00000010288 transcript:ENSGACT00000013621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMPMILTVYLSDGEQAATEVPITPETTCRDVVEFCKEPGESGCHLAEVWRGNERAIPFEH
MMYEHLQKWGPRKQEVKFFLRHEDSPTESSDQAGSQQSQDQTSRRSGSTGEKHSENGQGN
QRVELTLSELQEMATRQQQQIEAQQQMLVAKEQRLRYLKQQERRQQQTVSESEKLQKLKE
RVESQEAKLKKIRAMRGQVDYSKVINGNLSAEIEQVSSLFQEKQAELQSAVLRVEQLSLQ
LEDLRKGKLNGIQTALGSQVTGAAALELRKLYQELQIRNKLNQEQNSKLKQQKDLLNKRN
MEVTLMDKRISELRERLYKKKAEARQKENLPLNRANGPPSPQPATGTLGRVAAVGPYIQV
PVPGRQEGGYNVPPDPLKPQTLGVNNQANHGRIKSANDSGWPTLGKTNASLKPPERRDSG
ADTQGKSPPSGTSVAPSAEKDGKMAASSPAISKPQPPPYGSHLTVAHSASSLERRKDVPP
PRPLPNPPAPAWPRVAPSTGSSSQQIQQRISVPPSPTFQPNAPLFPPGLSERLDAPPAVA
VRPFIPDRGSRPQSPRKGPPTMNSSSIYHMYLQQAAPKSQPLKSALKAVYGKPVLNPSST
PPSPLPFVQAGGAFPLLQGPAGGEDALDGELDVPDFFQHPEPLAPPPSVENIPRPLSPTK
LTPMVHSPLRYQSDADLEVLRKKLANAPRPLKKRSSITEPEGPSGPNIQKLLYQRFNTLA
GGIEGSGVGGSAGGNGAGSGTPFYQPANPPAYQGGDSVTDKDNGNLPSETPGAEQPGFEA
PPPSTDTNDNEPPEMDPAEAAAGGSELLLPSPVLEASTPEESGALVSQPLDKRTNLKKPN
SERTGHGFRVKFNPLALLLDASLEGEFDLVQRIIYEVENPSTANDEGITPLHNAVCAGHH
HIVKFLLDFGVNVNAADSDGWTPLHCAASCNSVHLCKLLVESGAAIFASTISDVETAADK
CEEMEEGYIQCSQFLYGVQEKMGVMNKGTVYALWDYKAQNQDELAFGEGDAITILRRQDD
SETEWWWAQLEDNEGYVPRNLLGLYPRIKPRQRSLA
Download sequence
Identical sequences G3P7M2
69293.ENSGACP00000013596 ENSGACP00000013596 ENSGACP00000013596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]