SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013636 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013636
Domain Number 1 Region: 3-303
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.24e-89
Family G proteins 0.000000000199
Further Details:      
 
Domain Number 2 Region: 520-625
Classification Level Classification E-value
Superfamily PH domain-like 8.41e-24
Family Pleckstrin-homology domain (PH domain) 0.00000451
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013636   Gene: ENSGACG00000010312   Transcript: ENSGACT00000013661
Sequence length 883
Comment pep:known_by_projection group:BROADS1:groupXI:8137796:8160415:-1 gene:ENSGACG00000010312 transcript:ENSGACT00000013661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNRGMEDLIPLINKLQDAFSSIGQSCNLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLILQLVNNKAEYAEFLHCKGKKFVDFDEVRTEIEAETERITGSNKGISPIPI
NLRVYSPHVLNLTLIDLPGMTKVAVGDQPIDIEHQIRDMLMQFITKESCLILAVTPANTD
LANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDAKDILENKLLPLRRGYIGVVNRSQK
DIDGKKDIRAAMAAERKFFLSHPGYRHLAERMGTPHLQKTLNQQLTNHIRDTLPGLRSKL
QSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKCIEGSGDQVDTNELSGGA
KINRIFHERFPFELVKIVFDEKELRREISHAIKNVHGVRTGLFTPDLAFEVIVKKQIIKL
KTPCLKCIDLVIQELINTVRQCSNKLNSYPRLREETERIVTTHVREREGKTKDQVLLLID
IELSYINTNHEDFIGFANAQQRNTAANKKRAIPNQGEILVIRKGWLTINISIMKGGSKEY
WFVLTAESLSWYKDDEEKEKKYMLPLDNLKLRDVEKGFMSTKHIFAIFNTEQRNVYKDLR
QVELACDSQEDVDSWKASFLRAGVYPEKDQTENEDAAPPDTFSMDPQLERQVETIRNLVD
SYIGIINKSTRDLVPKTIMHLMINSAKDFIHSELLAYLYSSGDQGTLMEESADQAQRRDE
MLRMYHALKEALLIIGDISTGTISTPVPPPINDSWRQEASISPPLSPTPQRRPPPTASAA
PSRPPAARGATPGPPMNPSPAFGVPLNPSPAFGAPPIPSRPGPPINAFNSHQDPFSAPPM
IPSRPARVPPGVPSFSPRCSRRPPGAPSHRPTIIRPAEHSLLD
Download sequence
Identical sequences G3P7R2
ENSGACP00000013636 69293.ENSGACP00000013636 ENSGACP00000013636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]