SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013668 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013668
Domain Number 1 Region: 143-292
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-32
Family Pleckstrin-homology domain (PH domain) 0.0000139
Further Details:      
 
Domain Number 2 Region: 2-115
Classification Level Classification E-value
Superfamily PH domain-like 1.66e-22
Family Pleckstrin-homology domain (PH domain) 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013668   Gene: ENSGACG00000010343   Transcript: ENSGACT00000013693
Sequence length 414
Comment pep:known_by_projection group:BROADS1:groupVI:12820572:12831690:-1 gene:ENSGACG00000010343 transcript:ENSGACT00000013693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYVDRQNRNCGFLDIEENESSGKFLRRYFILDTQQGSLVWFMDNPQNLPAGTDCVGSLK
LTYISKVSDATKLRPKAEFCFVINAGMRKYFLQANDQQDLVDWVNALNNATKITVPKLSD
GQQNAENHKALPDVVGPKKQVSYKTEIFGGVPIVTQTQHDGGDGASRTEREALHRSHSQL
PYFQARPTQEHTVIKSGYCVKQGAVMRNWKRRYFLLEENSMSYFKSDLEKEPLRMIPLKE
VHKVHECKQSDIMMRDNLFEVVTTSRTFYIQADSQEEMHSWIKAVSGAIVAQRGPGRSAA
TDHGGRSHFYRRSPISAMPPCHPEWGAAVPYGTRPQPGVGQRALHEPAAPAQPQPRAGAP
FPAGGATGQVSREPPADGVNGAEESPWRRRSSFEPHVPESGVDLDDGDLPVSEV
Download sequence
Identical sequences G3P7U4
ENSGACP00000013668 ENSGACP00000013668 69293.ENSGACP00000013668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]